CD63 Protein-VLP, Human (HEK293)

CD63 Protein-VLP, Human (HEK293) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P705433.

The CD63 Protein functions as a cell surface receptor for TIMP1, contributing to the activation of cellular signaling cascades. It plays a pivotal role in the activation of ITGB1 and subsequent integrin signaling, leading to the activation of AKT, FAK/PTK2, and MAP kinases. This multifaceted protein is involved in diverse cellular processes, including promoting cell survival, orchestrating the reorganization of the actin cytoskeleton, enhancing cell adhesion, spreading, and migration through its involvement in AKT and FAK/PTK2 activation. Furthermore, CD63 participates in VEGFA signaling by regulating the internalization of KDR/VEGFR2 and influences intracellular vesicular transport processes. Its indispensable role in the trafficking of the PMEL luminal domain is crucial for the development and maturation of melanocytes. Additionally, CD63 contributes to leukocyte adhesion onto endothelial cells by regulating SELP trafficking. While it may play a role in mast cell degranulation in response to Ms4a2/FceRI stimulation, it appears to be dispensable for degranulation in response to other stimuli. CD63 interacts with TIMP1 and ITGB1, recruiting TIMP1 to ITGB1 complexes, and forms complexes with CD9 and ITGB3. It also interacts with PMEL and KDR/VEGFR2, the latter being essential for recruiting KDR to ITGB1 complexes, further emphasizing its intricate role in cellular processes.

Human

HEK293

Tag Free

P08962 (A2-M238)

967

Full Length

AVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM

Purity analysis by SDS-PAGE is not available for VLP proteins.

Solution.

Supplied as 0.2 μm filtered solution of PBS, Arginine, pH7.4 with trehalose as protectant.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.