CD63 Protein-VLP, Human (HEK293)

CD63 Protein-VLP, Human (HEK293) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P705433.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CD63 Protein-VLP, Human (HEK293) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P705433.

Background

The CD63 Protein functions as a cell surface receptor for TIMP1, contributing to the activation of cellular signaling cascades. It plays a pivotal role in the activation of ITGB1 and subsequent integrin signaling, leading to the activation of AKT, FAK/PTK2, and MAP kinases. This multifaceted protein is involved in diverse cellular processes, including promoting cell survival, orchestrating the reorganization of the actin cytoskeleton, enhancing cell adhesion, spreading, and migration through its involvement in AKT and FAK/PTK2 activation. Furthermore, CD63 participates in VEGFA signaling by regulating the internalization of KDR/VEGFR2 and influences intracellular vesicular transport processes. Its indispensable role in the trafficking of the PMEL luminal domain is crucial for the development and maturation of melanocytes. Additionally, CD63 contributes to leukocyte adhesion onto endothelial cells by regulating SELP trafficking. While it may play a role in mast cell degranulation in response to Ms4a2/FceRI stimulation, it appears to be dispensable for degranulation in response to other stimuli. CD63 interacts with TIMP1 and ITGB1, recruiting TIMP1 to ITGB1 complexes, and forms complexes with CD9 and ITGB3. It also interacts with PMEL and KDR/VEGFR2, the latter being essential for recruiting KDR to ITGB1 complexes, further emphasizing its intricate role in cellular processes.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag Tag Free
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD63 (A2-M238)
      Accession # P08962
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    CD63; Tetraspanin-30; Prev. MLA1; AD1 Antigen; TSPAN30; Tspan-30; CD63 Antigen; OMA81H; Pltgp40; Limp1; HOP-26; Lysosomal-Associated Membrane Protein 3; ME491; Lysosome Integral Membrane Protein 1; AD1; Melanoma-Associated Antigen MLA1; Ocular Melanoma-As

  • AA Sequence

    AVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM

  • Purity

    Purity analysis by SDS-PAGE is not available for VLP proteins.

Product Properties

Appearance

Solution

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00