CD69 Protein, Cynomolgus (HEK293, His)
CD69 protein, a key player in lymphocyte proliferation, acts as a signaling receptor in lymphocytes, natural killer (NK) cells, and platelets. It forms homodimers connected by disulfide bonds, highlighting its central role in cellular signaling for immune responses and platelet function. CD69 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD69 protein, expressed by HEK293 , with N-His labeled tag.
- Species: Cynomolgus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD69 protein, a key player in lymphocyte proliferation, acts as a signaling receptor in lymphocytes, natural killer (NK) cells, and platelets. It forms homodimers connected by disulfide bonds, highlighting its central role in cellular signaling for immune responses and platelet function. CD69 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived CD69 protein, expressed by HEK293 , with N-His labeled tag.
Background
The CD69 protein plays a pivotal role in lymphocyte proliferation, serving as a signal-transmitting receptor in lymphocytes, natural killer (NK) cells, and platelets. Structurally, it forms homodimers linked by disulfide bonds, emphasizing its involvement in cellular signaling processes crucial for immune responses and platelet function.
Technical Parameters
-
Species Cynomolgus
-
Source HEK293
-
Tag N-8*His
-
Accession
A0A2K5TSM3/XP_005570146.1 (S62-K199)
-
Molecular Construction
-
N-term
-
8*His
-
CD69 (S62-K199)
Accession # A0A2K5TSM3/XP_005570146.1 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD69; AIM; CD69 Molecule; EA1; CLEC2C; CDNA FLJ75888, Highly Similar To Homo Sapiens CD69 Antigen (P60, Early T-Cell Activation Antigen) (CD69), MRNA; CD69 Antigen (P60, Early T-Cell Activation Antigen); CDNA FLJ55409, Highly Similar To Early Activation A
-
AA Sequence
SVGQYNCPGQYTFSMPSDSHVSSCSDDWVSYQRKCYFISTVKRSWTSAQSACSEHGATLAVIDSVKDMNFLKRYAGGDEHWVGLKKEPGHPWKWSNGKEFNNWFNLTGSEKCAFLKNTEVSSMECEKNLYWICNKPYK
-
Predicted Molecular Mass
16.9 kDa
-
Molecular Weight
Approximately 23-28 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
