CD69 Protein, Mouse (HEK293, Fc)
CD69 Protein, a signal transmitting receptor, mediates lymphocyte proliferation in NK cells, platelets, and lymphocytes. It facilitates homodimer formation through disulfide-linkage. CD69 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD69 protein, expressed by HEK293 , with N-hFc labeled tag.
- Species: Mouse
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD69 Protein, a signal transmitting receptor, mediates lymphocyte proliferation in NK cells, platelets, and lymphocytes. It facilitates homodimer formation through disulfide-linkage. CD69 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived CD69 protein, expressed by HEK293 , with N-hFc labeled tag.
Background
CD69 Protein, a signal transmitting receptor, is involved in lymphocyte proliferation and functions in lymphocytes, natural killer (NK) cells, and platelets. It forms a homodimer through disulfide-linkage.
Technical Parameters
-
Species Mouse
-
Source HEK293
-
Tag N-hFc
-
Accession
P37217 (G64-R199)
-
Molecular Construction
-
N-term
-
hFc
-
CD69 (G64-R199)
Accession # P37217 -
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD69; AIM; CD69 Molecule; EA1; CLEC2C; CDNA FLJ75888, Highly Similar To Homo Sapiens CD69 Antigen (P60, Early T-Cell Activation Antigen) (CD69), MRNA; CD69 Antigen (P60, Early T-Cell Activation Antigen); CDNA FLJ55409, Highly Similar To Early Activation A
-
AA Sequence
GKYNCPGLYEKLESSDHHVATCKNEWISYKRTCYFFSTTTKSWALAQRSCSEDAATLAVIDSEKDMTFLKRYSGELEHWIGLKNEANQTWKWANGKEFNSWFNLTGSGRCVSVNHKNVTAVDCEANFHWVCSKPSR
-
Predicted Molecular Mass
44.1 kDa
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
