1. Recombinant Proteins
  2. Cytokines and Growth Factors Immune Checkpoint Proteins CAR-T Related Proteins CD Antigens Biotinylated Proteins
  3. TNF Superfamily Stimulatory Immune Checkpoint Molecules CD27 Ligand/CD70 NK Cell CD Proteins Macrophage CD Proteins
  4. TNF Superfamily Ligands
  5. CD70 Protein, Human (Biotinylated, HEK293, His-Avi&Flag)

CD70 Protein, Human (Biotinylated, HEK293, His-Avi&Flag)

Cat. No.: HY-P78560
Handling Instructions Technical Support

As a ligand of CD27, CD70 protein is an indispensable part of T cell immune coordination and is of particular importance in antiviral responses. The CD70-CD27 pathway emerged as a key player that contributes to the generation and maintenance of T cell-mediated immune responses. CD70 Protein, Human (Biotinylated, HEK293, His-Avi&Flag) is the recombinant human-derived CD70 protein, expressed by HEK293 , with N-Avi, N-Flag, N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
25 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
200 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 200 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

As a ligand of CD27, CD70 protein is an indispensable part of T cell immune coordination and is of particular importance in antiviral responses. The CD70-CD27 pathway emerged as a key player that contributes to the generation and maintenance of T cell-mediated immune responses. CD70 Protein, Human (Biotinylated, HEK293, His-Avi&Flag) is the recombinant human-derived CD70 protein, expressed by HEK293 , with N-Avi, N-Flag, N-His labeled tag.

Background

CD70, a cytokine functioning as the ligand for CD27, is integral to the CD70-CD27 pathway, which holds a crucial role in the development and sustenance of T cell immunity, especially in antiviral responses. Upon binding to CD27, CD70 induces the proliferation of costimulated T-cells and amplifies the generation of cytolytic T-cells, contributing to an effective immune response. Structurally, CD70 forms homotrimers, reflecting its molecular organization. The CD70-CD27 interaction underscores its significance in orchestrating T cell-mediated immune responses, providing valuable insights into the regulation of immune functions.

Biological Activity

Immobilized Human CD27 Fc at 2 μg/mL (100 μL/well) can bind Biotinylated Human CD27 Ligand His-Avi-Flag with a linear range of 0.1-4 ng/mL.

Species

Human

Source

HEK293

Tag

N-Avi;N-Flag;N-His

Accession

P32970-1 (S52-P193)

Gene ID

970  [NCBI]

Molecular Construction
N-term
C-term
Protein Length

Partial

Conjugation

Biotin

Synonyms
CD70; CD27LG; TNFSF7; TNFSF7G; CD27L
AA Sequence

SLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP

Molecular Weight

47-57 kDa

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.22 μm filtered solution of PBS, pH 7.4. Normally trehalose is added as protectant before lyophilization.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CD70 Protein, Human (Biotinylated, HEK293, His-Avi&Flag)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD70 Protein, Human (Biotinylated, HEK293, His-Avi&Flag)
Cat. No.:
HY-P78560
Quantity:
MCE Japan Authorized Agent: