CD73/5'-Nucleotidase Protein, Rabbit (HEK293, His)

CD73/5'-Nucleotidase Protein hydrolyzes nucleotide monophosphates, favoring AMP as the primary substrate and showing a preference for ribonucleotide monophosphates. It releases inorganic phosphate and the corresponding nucleoside. CD73 also acts on other substrates, including IMP, UMP, GMP, CMP, dAMP, dCMP, dTMP, NAD, and NMN. CD73/5'-Nucleotidase Protein, Rabbit (HEK293, His) is the recombinant Rabbit-derived CD73/5'-Nucleotidase protein, expressed by HEK293 , with C-His labeled tag. The total length of CD73/5'-Nucleotidase Protein, Rabbit (HEK293, His) is 524 a.a., with molecular weight of 60-65 kDa.

For research use only. We do not sell to patients.
  • Species: Rabbit
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CD73/5'-Nucleotidase Protein hydrolyzes nucleotide monophosphates, favoring AMP as the primary substrate and showing a preference for ribonucleotide monophosphates. It releases inorganic phosphate and the corresponding nucleoside. CD73 also acts on other substrates, including IMP, UMP, GMP, CMP, dAMP, dCMP, dTMP, NAD, and NMN. CD73/5'-Nucleotidase Protein, Rabbit (HEK293, His) is the recombinant Rabbit-derived CD73/5'-Nucleotidase protein, expressed by HEK293 , with C-His labeled tag. The total length of CD73/5'-Nucleotidase Protein, Rabbit (HEK293, His) is 524 a.a., with molecular weight of 60-65 kDa.

Background

The CD73/5'-Nucleotidase protein assumes a crucial role in cellular processes by catalyzing the hydrolysis of nucleotide monophosphates, releasing inorganic phosphate and the corresponding nucleoside. Notably, AMP stands out as the preferred substrate for this enzyme, emphasizing its significance in the conversion of adenylate nucleotides. CD73/5'-Nucleotidase exhibits a preference for ribonucleotide monophosphates over their deoxyribose counterparts, showcasing its selectivity in substrate recognition. In addition to AMP, other substrates include IMP, UMP, GMP, CMP, dAMP, dCMP, dTMP, NAD, and NMN, further illustrating the versatility of CD73/5'-Nucleotidase in nucleotide metabolism and its role in regulating the balance of nucleotide pools within the cell.

Technical Parameters

  • Species Rabbit
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CD73 (W27-S550)
      Accession # XP_002714603
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    NT5E; ENT; Prev. NT5; 5'-NT; IMP-Specific 5'-Nucleotidase; NTE; Thymidylate 5'-Phosphatase; 5'-Nucleotidase, Ecto (CD73); 5'-Deoxynucleotidase; Purine 5-Prime-Nucleotidase; Ecto-5'-Nucleotidase; 5' Nucleotidase (CD73); 5'-Nucleotidase; CD73 Antigen; CALJA

  • AA Sequence

    WELTILHTNDVHSRLEQINQEGSSKCVNASLCVGGVARLFTKVQQIRQAEQNVLLLDAGDQYQGTIWFMVYKGAEVAHFMNLLSYDAMALGNHEFDNGVKGLIDPLLKEAKFPILSANIKAKGSLASEISGLYLPYKILNVGNEVVGIVGYTSKETPFLSNPGTDLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFETDKLIAQKVKGVDVVVGGHSNTFLYTGNPPSSEVPAGKYPFIVTSDDGRKVPVVQAYAFGKYLGYLKVDFDEKGNVITSHGNPILLNSSIPEDPSIKAEINEWRIKLDNYSTKALGKTIVYLDGSTQSCRFKECNMGNMICDAMINNNLRHSDEMFWNHVSMCILNGGGIRSPIDEKNNGTITWENLAAVLPFGGTFDLVQLKGSTLKKAFEHSVHRYGQSTGEFLQVGGIHVVYDLSRRPGDRVVQLDVLCTKCRVPSYEPLKMDEVYKVILPSFLATGGDGFQMIKDELLRHDSGEQDISVVCQYISKMQVIYPAVEGRIKFS

  • Predicted Molecular Mass

    59.8 kDa

  • Molecular Weight

    Approximately 60-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00