CD73/5'-Nucleotidase Protein, Rabbit (HEK293, His)
CD73/5'-Nucleotidase Protein hydrolyzes nucleotide monophosphates, favoring AMP as the primary substrate and showing a preference for ribonucleotide monophosphates. It releases inorganic phosphate and the corresponding nucleoside. CD73 also acts on other substrates, including IMP, UMP, GMP, CMP, dAMP, dCMP, dTMP, NAD, and NMN. CD73/5'-Nucleotidase Protein, Rabbit (HEK293, His) is the recombinant Rabbit-derived CD73/5'-Nucleotidase protein, expressed by HEK293 , with C-His labeled tag. The total length of CD73/5'-Nucleotidase Protein, Rabbit (HEK293, His) is 524 a.a., with molecular weight of 60-65 kDa.
- Species: Rabbit
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CD73/5'-Nucleotidase Protein hydrolyzes nucleotide monophosphates, favoring AMP as the primary substrate and showing a preference for ribonucleotide monophosphates. It releases inorganic phosphate and the corresponding nucleoside. CD73 also acts on other substrates, including IMP, UMP, GMP, CMP, dAMP, dCMP, dTMP, NAD, and NMN. CD73/5'-Nucleotidase Protein, Rabbit (HEK293, His) is the recombinant Rabbit-derived CD73/5'-Nucleotidase protein, expressed by HEK293 , with C-His labeled tag. The total length of CD73/5'-Nucleotidase Protein, Rabbit (HEK293, His) is 524 a.a., with molecular weight of 60-65 kDa.
Background
The CD73/5'-Nucleotidase protein assumes a crucial role in cellular processes by catalyzing the hydrolysis of nucleotide monophosphates, releasing inorganic phosphate and the corresponding nucleoside. Notably, AMP stands out as the preferred substrate for this enzyme, emphasizing its significance in the conversion of adenylate nucleotides. CD73/5'-Nucleotidase exhibits a preference for ribonucleotide monophosphates over their deoxyribose counterparts, showcasing its selectivity in substrate recognition. In addition to AMP, other substrates include IMP, UMP, GMP, CMP, dAMP, dCMP, dTMP, NAD, and NMN, further illustrating the versatility of CD73/5'-Nucleotidase in nucleotide metabolism and its role in regulating the balance of nucleotide pools within the cell.
Technical Parameters
-
Species Rabbit
-
Source HEK293
-
Tag C-His
-
Accession
XP_002714603 (W27-S550)
-
Molecular Construction
-
N-term
-
CD73 (W27-S550)
Accession # XP_002714603 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
NT5E; ENT; Prev. NT5; 5'-NT; IMP-Specific 5'-Nucleotidase; NTE; Thymidylate 5'-Phosphatase; 5'-Nucleotidase, Ecto (CD73); 5'-Deoxynucleotidase; Purine 5-Prime-Nucleotidase; Ecto-5'-Nucleotidase; 5' Nucleotidase (CD73); 5'-Nucleotidase; CD73 Antigen; CALJA
-
AA Sequence
WELTILHTNDVHSRLEQINQEGSSKCVNASLCVGGVARLFTKVQQIRQAEQNVLLLDAGDQYQGTIWFMVYKGAEVAHFMNLLSYDAMALGNHEFDNGVKGLIDPLLKEAKFPILSANIKAKGSLASEISGLYLPYKILNVGNEVVGIVGYTSKETPFLSNPGTDLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFETDKLIAQKVKGVDVVVGGHSNTFLYTGNPPSSEVPAGKYPFIVTSDDGRKVPVVQAYAFGKYLGYLKVDFDEKGNVITSHGNPILLNSSIPEDPSIKAEINEWRIKLDNYSTKALGKTIVYLDGSTQSCRFKECNMGNMICDAMINNNLRHSDEMFWNHVSMCILNGGGIRSPIDEKNNGTITWENLAAVLPFGGTFDLVQLKGSTLKKAFEHSVHRYGQSTGEFLQVGGIHVVYDLSRRPGDRVVQLDVLCTKCRVPSYEPLKMDEVYKVILPSFLATGGDGFQMIKDELLRHDSGEQDISVVCQYISKMQVIYPAVEGRIKFS
-
Predicted Molecular Mass
59.8 kDa
-
Molecular Weight
Approximately 60-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
