1. Recombinant Proteins
  2. Immune Checkpoint Proteins CD Antigens Enzymes & Regulators
  3. Inhibitory Checkpoint Molecules T Cell CD Proteins Macrophage CD Proteins Stem Cell CD Proteins Epithelial cell CD Proteins Endothelial cell CD Proteins Hydrolases (EC 3)
  4. CD73
  5. CD73/5'-Nucleotidase Protein, Rabbit (HEK293, His)

CD73/5'-Nucleotidase Protein, Rabbit (HEK293, His)

Cat. No.: HY-P78610
Handling Instructions Technical Support

CD73/5'-Nucleotidase Protein hydrolyzes nucleotide monophosphates, favoring AMP as the primary substrate and showing a preference for ribonucleotide monophosphates. It releases inorganic phosphate and the corresponding nucleoside. CD73 also acts on other substrates, including IMP, UMP, GMP, CMP, dAMP, dCMP, dTMP, NAD, and NMN. CD73/5'-Nucleotidase Protein, Rabbit (HEK293, His) is the recombinant Rabbit-derived CD73/5'-Nucleotidase protein, expressed by HEK293 , with C-His labeled tag. The total length of CD73/5'-Nucleotidase Protein, Rabbit (HEK293, His) is 524 a.a., with molecular weight of 60-65 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
100 μg Get quote 2 - 3 Weeks 1 - 2 Weeks 3 - 4 Weeks 2 - 3 weeks
> 100 μg   Get quote  
Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CD73/5'-Nucleotidase Protein hydrolyzes nucleotide monophosphates, favoring AMP as the primary substrate and showing a preference for ribonucleotide monophosphates. It releases inorganic phosphate and the corresponding nucleoside. CD73 also acts on other substrates, including IMP, UMP, GMP, CMP, dAMP, dCMP, dTMP, NAD, and NMN. CD73/5'-Nucleotidase Protein, Rabbit (HEK293, His) is the recombinant Rabbit-derived CD73/5'-Nucleotidase protein, expressed by HEK293 , with C-His labeled tag. The total length of CD73/5'-Nucleotidase Protein, Rabbit (HEK293, His) is 524 a.a., with molecular weight of 60-65 kDa.

Background

The CD73/5'-Nucleotidase protein assumes a crucial role in cellular processes by catalyzing the hydrolysis of nucleotide monophosphates, releasing inorganic phosphate and the corresponding nucleoside. Notably, AMP stands out as the preferred substrate for this enzyme, emphasizing its significance in the conversion of adenylate nucleotides. CD73/5'-Nucleotidase exhibits a preference for ribonucleotide monophosphates over their deoxyribose counterparts, showcasing its selectivity in substrate recognition. In addition to AMP, other substrates include IMP, UMP, GMP, CMP, dAMP, dCMP, dTMP, NAD, and NMN, further illustrating the versatility of CD73/5'-Nucleotidase in nucleotide metabolism and its role in regulating the balance of nucleotide pools within the cell.

Species

Rabbit

Source

HEK293

Tag

C-His

Accession

XP_002714603 (W27-S550)

Gene ID
Molecular Construction
N-term
CD73 (W27-S550)
Accession # XP_002714603
His
C-term
Protein Length

Partial

Synonyms
CD73; NT5E; 5'-Nucleotidase; 5'-NT; NT5; NTE
AA Sequence

WELTILHTNDVHSRLEQINQEGSSKCVNASLCVGGVARLFTKVQQIRQAEQNVLLLDAGDQYQGTIWFMVYKGAEVAHFMNLLSYDAMALGNHEFDNGVKGLIDPLLKEAKFPILSANIKAKGSLASEISGLYLPYKILNVGNEVVGIVGYTSKETPFLSNPGTDLVFEDEITALQPEVDKLKTLNVNKIIALGHSGFETDKLIAQKVKGVDVVVGGHSNTFLYTGNPPSSEVPAGKYPFIVTSDDGRKVPVVQAYAFGKYLGYLKVDFDEKGNVITSHGNPILLNSSIPEDPSIKAEINEWRIKLDNYSTKALGKTIVYLDGSTQSCRFKECNMGNMICDAMINNNLRHSDEMFWNHVSMCILNGGGIRSPIDEKNNGTITWENLAAVLPFGGTFDLVQLKGSTLKKAFEHSVHRYGQSTGEFLQVGGIHVVYDLSRRPGDRVVQLDVLCTKCRVPSYEPLKMDEVYKVILPSFLATGGDGFQMIKDELLRHDSGEQDISVVCQYISKMQVIYPAVEGRIKFS

Molecular Weight

60-65 kDa

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized a 0.22 μm filtered solution of 20 mM Tris, 120 mM NaCl, pH 7.5. Normally trehalose is added as protectant before lyophilization.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CD73/5'-Nucleotidase Protein, Rabbit (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CD73/5'-Nucleotidase Protein, Rabbit (HEK293, His)
Cat. No.:
HY-P78610
Quantity:
MCE Japan Authorized Agent: