CD79B Protein, Cynomolgus (Biotinylated, HEK293, His-Avi)

CD79B protein binds to CD79A and initiates the B cell antigen receptor complex (BCR) signaling cascade. This results in complex internalization, transport to late endosomes and antigen presentation. CD79B Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) is the recombinant cynomolgus-derived CD79B protein, expressed by HEK293 , with C-Avi, C-His labeled tag. The total length of CD79B Protein, Cynomolgus (Biotinylated, HEK293, His-Avi) is 132 a.a., with molecular weight of 30-35 kDa.

CD79B Protein plays an essential role in conjunction with CD79A in initiating the signal transduction cascade triggered by the B-cell antigen receptor complex (BCR). This pivotal function leads to the internalization of the complex, subsequent trafficking to late endosomes, and eventual antigen presentation. CD79B enhances the phosphorylation of CD79A, potentially by recruiting kinases that phosphorylate CD79A or by engaging proteins that bind to CD79A, safeguarding it from dephosphorylation. Forming a heterodimer with the alpha chain, CD79B forms a disulfide-linked complex. It is an integral component of the B-cell antigen receptor complex, where the alpha/beta chain heterodimer associates non-covalently with an antigen-specific membrane-bound surface immunoglobulin comprising two heavy chains and two light chains. Additionally, CD79B interacts with LYN, further contributing to its regulatory role in B-cell signaling.

Cynomolgus

HEK293

C-Avi;C-His

A0A2K5WTH8 (A30-D161)

/

Biotin

AKSEDLYPNPKGSACSRIWQSPRFIARKRGFTVKMHCYVTNSTFSIVSWLRKRETDKEPQQVNLEQGHMHQTQNSSVTTLIIQDIRFEDNGIYFCQQECSKTSEVYRGCGTELRVMGFSTLAQLKQRNTLKD

30-35 kDa

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized a 0.22 μm filtered solution of PBS, 0.2 M Arginine, pH 7.4. Normally trehalose is added as protectant before lyophilization.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.