Copy Link Print Information

CD79B Protein, Rat (HEK293, Fc)

CD79B Protein, also known as B29 or Igβ, is an essential component of the B cell receptor along with immunoglobulin and mb1 (Igα, CD79a) and is absolutely required for B cell development. Rat CD79B protein comprises 228 amino acids, and its amino acid sequence is 85 and 69% identical with the mouse and human counterparts, respectively. The B-cell antigen receptor (BCR) signaling component Igβ (CD79B) and the co-receptor CD19 act as an alternative B-cell signaling module that promotes the survival of B lymphoma and normal B cells via integrated ITAM/PI3K signaling. The loss of CD79B causes a block in N-glycan maturation and accumulation of immature proteins. CD79B Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD79B protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • CD79B Protein, Rat (HEK293, Fc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CD79B Protein, also known as B29 or Igβ, is an essential component of the B cell receptor along with immunoglobulin and mb1 (Igα, CD79a) and is absolutely required for B cell development. Rat CD79B protein comprises 228 amino acids, and its amino acid sequence is 85 and 69% identical with the mouse and human counterparts, respectively. The B-cell antigen receptor (BCR) signaling component Igβ (CD79B) and the co-receptor CD19 act as an alternative B-cell signaling module that promotes the survival of B lymphoma and normal B cells via integrated ITAM/PI3K signaling. The loss of CD79B causes a block in N-glycan maturation and accumulation of immature proteins[1][2][3]. CD79B Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD79B protein, expressed by HEK293 , with C-hFc labeled tag.

Background

The human, murine, and rat B29 (Ig beta, CD79b) genes are highly conserved in sequence and organization and exhibit strict B cell-specific expression. In the human and rat genomes, the B29 gene is located between the skeletal muscle-specific Na-channel alpha subunit (SCN4A) gene and the pituitary-specific growth hormone (GH-N) gene. Rat B29/Ig-β gene was 3.1 kb in length with six exons and was separated by 3.3 and 9.3 kb from Na-channel and GH genes, respectively[1][2].
The B-cell receptor (BCR) consists of surface-bound immunoglobulin (Ig) and a heterodimeric signaling unit comprised of CD79A and CD79B. Upon cognate antigen recognition, the receptor initiates important signals for B-cell development and function[3].

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag C-hFc
  • Accession

    O70153 (V26-D158)

  • Gene ID
    171055  [NCBI]
  • Molecular Construction
    • N-term
    • CD79B (V26-D158)
      Accession # O70153
    • hFc
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CD79B; CD79b Molecule, Immunoglobulin-Associated Beta; Prev. IGB; B-Cell-Specific Glycoprotein B29; Ig-Beta; B-Cell Antigen Receptor Complex-Associated Protein Beta Chain Isoform 3; B29; CD79b Antigen; B-Cell Antigen Receptor Complex-Associated Protein Be

  • AA Sequence

    VPAMTKSDQPPIFQGSPCSKIWQHPRFAAKKRSSMVKFHCHTDYSGVMTWFRQKGNQRPQELFPEDGHISQTRNGSVYTLTLQNIQYEDNGIYFCQQKCNSTEPDVTDGCGTELLVLGFSTLDQLKRRNTLKD

  • Predicted Molecular Mass

    42.2 kDa

  • Molecular Weight

    Approximately 50 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • CD79B Protein, Rat (HEK293, Fc) Product Image
    1/16
  • CD79B Protein, Rat (HEK293, Fc) Product Image