CD79B Protein, Rat (HEK293, His)

CD79B Protein, also known as B29 or Igβ, is an essential component of the B cell receptor along with immunoglobulin and mb1 (Igα, CD79a) and is absolutely required for B cell development. Rat CD79B protein comprises 228 amino acids, and its amino acid sequence is 85 and 69% identical with the mouse and human counterparts, respectively. The B-cell antigen receptor (BCR) signaling component Igβ (CD79B) and the co-receptor CD19 act as an alternative B-cell signaling module that promotes the survival of B lymphoma and normal B cells via integrated ITAM/PI3K signaling. The loss of CD79B causes a block in N-glycan maturation and accumulation of immature proteins^[1][2][3]. CD79B Protein, Rat (HEK293, His) is the recombinant rat-derived CD79B protein, expressed by HEK293 , with C-His labeled tag.

The human, murine, and rat B29 (Ig beta, CD79b) genes are highly conserved in sequence and organization and exhibit strict B cell-specific expression. In the human and rat genomes, the B29 gene is located between the skeletal muscle-specific Na-channel alpha subunit (SCN4A) gene and the pituitary-specific growth hormone (GH-N) gene. Rat B29/Ig-β gene was 3.1 kb in length with six exons and was separated by 3.3 and 9.3 kb from Na-channel and GH genes, respectively^[1][2].
The B-cell receptor (BCR) consists of surface-bound immunoglobulin (Ig) and a heterodimeric signaling unit comprised of CD79A and CD79B. Upon cognate antigen recognition, the receptor initiates important signals for B-cell development and function^[3].

Immobilized Human CD79B at 2 μg/mL (100 μL/well) can bind Anti-CD79B Antibody. The ED₅₀ for this effect is 0.7885 μg/mL.

• 
  Immobilized Human CD79B at 2 μg/mL (100 μL/well) can bind Anti-CD79B Antibody. The ED₅₀ for this effect is 0.7885 μg/mL.

Rat

HEK293

C-6*His

O70153 (V26-D158)

171055  [NCBI]

Partial

VPAMTKSDQPPIFQGSPCSKIWQHPRFAAKKRSSMVKFHCHTDYSGVMTWFRQKGNQRPQELFPEDGHISQTRNGSVYTLTLQNIQYEDNGIYFCQQKCNSTEPDVTDGCGTELLVLGFSTLDQLKRRNTLKD

Approximately 25-30 kDa due to the glycosylation.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Lisa Patrone, et al. A conserved sequence upstream of the B29 (Ig beta, CD79b) gene interacts with YY1. Mol Biol Rep. 2004 Mar;31(1):1-11.  [Content Brief]

  [2]. S Nakazato, et al. Physical linkage of the B29/Ig-beta (CD79B) gene to the skeletal muscle, sodium-channel, and growth hormone genes in rat and human. Genomics. 1998 Mar 15;48(3):363-8.  [Content Brief]

  [3]. Kanutte Huse, et al. Mechanism of CD79A and CD79B Support for IgM+ B Cell Fitness through B Cell Receptor Surface Expression. J Immunol. 2022 Nov 15;209(10):2042-2053.  [Content Brief]