CD83 Protein, Rat (HEK293, Fc)

The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD83 protein, expressed by HEK293 , with C-hFc labeled tag.

CD83 Protein is suggested to play a significant role, potentially contributing to antigen presentation or mediating cellular interactions that ensue following lymphocyte activation. The specific mechanisms through which CD83 influences these processes, particularly in the context of immune responses, remain to be fully elucidated. As a monomer, CD83 may participate in distinct molecular events that impact antigen presentation and cellular interactions, highlighting its potential as a key regulatory element in modulating immune responses. In-depth investigations are needed to unravel the intricacies of CD83's function and its implications in the orchestration of immune processes.

Rat

HEK293

C-hFc

A6J740 (M22-A134)

361226  [NCBI]

Partial

MREVTVACSETADLPCTAPWDPQLSYTVSWAKVSESGNERLELPESKQNSSVEAPKKRPYSLTIQNTTICSAGTYRCALQELGGQRNFSGTVVLKVTGCPKEATESTFRKYRA

Approximately 53 kDa,based on SDS-PAGE under reducing conditions.

≥ 80%, as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.