CD83 Protein, Rat (HEK293, Fc)
The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD83 protein, expressed by HEK293 , with C-hFc labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The CD83 protein is involved in antigen presentation or mediating cell interactions following lymphocyte activation. The specific mechanisms by which CD83 affects these processes in the immune response have not been fully elucidated. CD83 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD83 protein, expressed by HEK293 , with C-hFc labeled tag.
Background
CD83 Protein is suggested to play a significant role, potentially contributing to antigen presentation or mediating cellular interactions that ensue following lymphocyte activation. The specific mechanisms through which CD83 influences these processes, particularly in the context of immune responses, remain to be fully elucidated. As a monomer, CD83 may participate in distinct molecular events that impact antigen presentation and cellular interactions, highlighting its potential as a key regulatory element in modulating immune responses. In-depth investigations are needed to unravel the intricacies of CD83's function and its implications in the orchestration of immune processes.
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-hFc
-
Accession
A6J740 (M22-A134)
-
Molecular Construction
-
N-term
-
CD83 (M22-A134)
Accession # A6J740 -
hFc
-
C-term
-
-
Protein Length
Partial
-
Synonyms
CD83; Cell Surface Protein HB15; CD83 Molecule; CD83 Antigen; HB15; HCD83; BL11; Cell-Surface Glycoprotein; CD83 Antigen (Activated B Lymphocytes, Immunoglobulin Superfamily); B-Cell Activation Protein
-
AA Sequence
MREVTVACSETADLPCTAPWDPQLSYTVSWAKVSESGNERLELPESKQNSSVEAPKKRPYSLTIQNTTICSAGTYRCALQELGGQRNFSGTVVLKVTGCPKEATESTFRKYRA
-
Predicted Molecular Mass
39.4 kDa
-
Molecular Weight
Approximately 53 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 80%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
