CD9 Protein-Nanodisc, Human (HEK293, His, GFP)

CD9 protein is an integral membrane protein that plays a critical regulatory role in processes such as sperm-egg fusion, platelet activation, and cell adhesion. CD9 is critical for sperm-egg fusion, coordinating multi-protein complexes on the oocyte surface. CD9 Protein-Nanodisc, Human (HEK293, His, GFP) is the recombinant human-derived CD9 protein, expressed by HEK293, with N-His and N-GFP labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CD9 protein is an integral membrane protein that plays a critical regulatory role in processes such as sperm-egg fusion, platelet activation, and cell adhesion. CD9 is critical for sperm-egg fusion, coordinating multi-protein complexes on the oocyte surface. CD9 Protein-Nanodisc, Human (HEK293, His, GFP) is the recombinant human-derived CD9 protein, expressed by HEK293, with N-His and N-GFP labeled tag.

Background

CD9, an integral membrane protein, plays a pivotal role in regulating various biological processes, including sperm-egg fusion, platelet activation and aggregation, and cell adhesion. Located at the cell surface of oocytes, CD9 is essential for sperm-egg fusion, potentially by orchestrating multiprotein complexes and membrane morphology required for the fusion process. In myoblasts, CD9 associates with CD81 and PTGFRN, inhibiting myotube fusion during muscle regeneration. Within macrophages, CD9 forms associations with CD81 and beta-1/beta-2 integrins, preventing macrophage fusion into multinucleated giant cells specialized in ingesting complement-opsonized large particles. CD9 also hinders the fusion of mononuclear cell progenitors into osteoclasts responsible for bone resorption. Beyond its role in fusion events, CD9 acts as a receptor for PSG17 and is implicated in platelet activation, aggregation, paranodal junction formation, cell adhesion, cell motility, and tumor metastasis. CD9 forms disulfide-linked homodimers and higher homooligomers, as well as heterooligomers with other tetraspanin family members. It interacts with integrins ITGAV:ITGB3 and ITGA6:ITGB1, and is part of integrin-tetraspanin complexes in the membrane of monocytes/macrophages. CD9 forms complexes with CD63, PTGFRN, IGSF8, CR2/CD21, and PDPN, playing a crucial role in diverse cellular functions and interactions in various contexts.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag N-His;GFP
  • Accession
  • Gene ID
  • Protein Length

    Full Length

  • Synonyms

    CD9; CD9 Antigen (P24); Prev. MIC3; BA2; TSPAN29; Motility-Related Protein; MRP-1; BA-2/P24 Antigen; Tetraspanin-29; Antigen CD9; CD9 Antigen; Tetraspanin; P24; TSPAN-29; Cell Growth-Inhibiting Gene 2 Protein; Tspan-29; Motility Related Protein-1; DRAP-27

  • AA Sequence

    MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGVYILIGAGALMMLVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAAAIWGYSHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRNREMV

  • Predicted Molecular Mass

    53.7 kDa

  • Molecular Weight

    Approximately 51 kDa, based on SDS-PAGE under reducing conditions.

  • Glycosylation

    Yes

  • Purity

    ≥ 80%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00