Copy Link Print Information

CD99 Protein, Rat (HEK293, Fc)

Customer Review

Based on 1 Customer Validation

CD99 protein is a member of the CD99 family and plays a key role in several important cellular processes such as immune response, cell adhesion and migration. It exerts a major influence on lymphocyte trafficking and is involved in the regulation of immune cell interactions. CD99 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD99 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for CD99 Protein, Rat (HEK293, Fc)
  • Experimental Validation Results for CD99 Protein, Rat (HEK293, Fc)
  • CD99 Protein, Rat (HEK293, Fc) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

CD99 protein is a member of the CD99 family and plays a key role in several important cellular processes such as immune response, cell adhesion and migration. It exerts a major influence on lymphocyte trafficking and is involved in the regulation of immune cell interactions. CD99 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD99 protein, expressed by HEK293 , with C-hFc labeled tag.

Background

CD99 Protein, a member of the CD99 family, is a key player in several important cellular processes, including immune responses, cell adhesion, and migration. It exerts significant influence on lymphocyte trafficking and is involved in the regulation of immune cell interactions. CD99 Protein is known to be expressed on various immune cells, where it contributes to the formation of immunological synapses and facilitates the communication between different immune cells. Additionally, CD99 Protein is implicated in cell adhesion and migration processes, playing a crucial role in the transmigration of leukocytes across endothelial cell barriers. Through its multifaceted functions, CD99 Protein is essential for the proper functioning of the immune system and the coordination of immune responses.

Verified Bioactivity

Measured by its ability to chemoattract U87 cells. The ED50 for this effect is 21.43 ng/mL, corresponding to a specific activity is 4.67×104 U/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to chemoattract U87 cells. The ED50 for this effect is 21.43 ng/mL, corresponding to a specific activity is 4.67×104 U/mg.

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag C-hFc
  • Accession

    B4F7A5 (D25-G127)

  • Gene ID
    652929  [NCBI]
  • Molecular Construction
    • N-term
    • CD99 (D25-G127)
      Accession # B4F7A5
    • hFc
    • C-term
  • Protein Length

    Full Length of Disordered Region

  • Synonyms

    CD99; MIC2 (Monoclonal Antibody 12E7); Prev. MIC2X; Cell Surface Antigen 12E7; Prev. MIC2Y; Cell Surface Antigen O13; Prev. MIC2; Surface Antigen MIC2; CD99 Antigen; CD99 Molecule; Antigen Identified By Monoclonal Antibodies 12E7, F21 And O13; Protein MIC

  • AA Sequence

    DGDFRLDDALEDTDKKPTPKPPTPKKPSSGDFDLEEALTGGADEDPRRPGSRPKPDPKPPGPPRDSGGISDRDLEDVAGHGGRGGGAGDRGTDGAESEGQPQG

  • Molecular Weight

    Approximately 47 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to chemoattract U87 cells. The ED50 for this effect is 21.43 ng/mL, corresponding to a specific activity is 4.67×104 U/mg.

  • CD99 Protein, Rat (HEK293, Fc) Product Image
    1/16
  • Experimental Validation Results for CD99 Protein, Rat (HEK293, Fc)
  • Experimental Validation Results for CD99 Protein, Rat (HEK293, Fc)
  • CD99 Protein, Rat (HEK293, Fc) Product Image