CD99 Protein, Rat (HEK293, Fc)

CD99 protein is a member of the CD99 family and plays a key role in several important cellular processes such as immune response, cell adhesion and migration. It exerts a major influence on lymphocyte trafficking and is involved in the regulation of immune cell interactions. CD99 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD99 protein, expressed by HEK293 , with C-hFc labeled tag.

CD99 Protein, a member of the CD99 family, is a key player in several important cellular processes, including immune responses, cell adhesion, and migration. It exerts significant influence on lymphocyte trafficking and is involved in the regulation of immune cell interactions. CD99 Protein is known to be expressed on various immune cells, where it contributes to the formation of immunological synapses and facilitates the communication between different immune cells. Additionally, CD99 Protein is implicated in cell adhesion and migration processes, playing a crucial role in the transmigration of leukocytes across endothelial cell barriers. Through its multifaceted functions, CD99 Protein is essential for the proper functioning of the immune system and the coordination of immune responses.

Measured by its ability to chemoattract U87 cells. The ED₅₀ for this effect is 21.43 ng/mL, corresponding to a specific activity is 4.67×10⁴ U/mg.

• 
  Measured by its ability to chemoattract U87 cells. The ED₅₀ for this effect is 21.43 ng/mL, corresponding to a specific activity is 4.67×10⁴ U/mg.

Rat

HEK293

C-hFc

B4F7A5 (D25-G127)

652929  [NCBI]

Partial

DGDFRLDDALEDTDKKPTPKPPTPKKPSSGDFDLEEALTGGADEDPRRPGSRPKPDPKPPGPPRDSGGISDRDLEDVAGHGGRGGGAGDRGTDGAESEGQPQG

Approximately 48 kDa

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.