CEACAM21 Protein, Human (HEK293, His)
Based on 1 Customer Validation
CEA21/CEACAM21, a carcinoembryonic antigen (CEA)-related cell adhesion molecule, is expressed on granulocytes. CEACAM21 is also a biological candidate gene for schizophrenia and type I diabetes, with SNPs consistently associated with the disease. CEACAM21 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM21 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CEA21/CEACAM21, a carcinoembryonic antigen (CEA)-related cell adhesion molecule, is expressed on granulocytes. CEACAM21 is also a biological candidate gene for schizophrenia and type I diabetes, with SNPs consistently associated with the disease. CEACAM21 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM21 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
CEA21/CEACAM21, a carcinoembryonic antigen (CEA)-related cell adhesion molecule, is expressed by CEACAM21. CEA21 may be a component of membranes and is widely expressed in tissues such as bone marrow and lymph nodes. CEA21 is an innate immune receptor expressed on granulocytes and targets specific human pathogens. CEACAM21 is also a biologically plausible candidate gene for schizophrenia. CEACAM21 contains a predicted intron (a region containing a large number of human spliced ESTs and mRNAs) with SNPs consistently associated with increased risk of schizophrenia. CEACAM21 is also a Type I Diabetes Genetics Consortium candidate gene with significant association.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q3KPI0-1/AAI06728.1 (W35-G240)
-
Molecular Construction
-
N-term
-
CEACAM21 (W35-G240)
Accession # Q3KPI0-1/AAI06728.1 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CEACAM21; Carcinoembryonic Antigen Related Cell Adhesion Molecule 21; CEA Cell Adhesion Molecule 21; Cell Adhesion Molecule CEACAM21; Carcinoembryonic Antigen-Related Cell Adhesion Molecule 21; FLJ13540; R29124_1
-
AA Sequence
WLFIASAPFEVAEGENVHLSVVYLPENLYSYGWYKGKTVEPNQLIAAYVIDTHVRTPGPAYSGRETISPSGDLHFQNVTLEDTGYYNLQVTYRNSQIEQASHHLRVYESVAQPSIQASSTTVTEKGSVVLTCHTNNTGTSFQWIFNNQRLQVTKRMKLSWFNHVLTIDPIRQEDAGEYQCEVSNPVSSNRSDPLKLTVKSDDNTLG
-
Predicted Molecular Mass
24.2 kDa
-
Molecular Weight
Approximately 35 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (260 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
