CEACAM3 Protein, Human (HEK293, His)
Based on 1 Customer Validation
The CEACAM3 protein is a key granulocyte receptor that effectively orchestrates the opsonin-independent phagocytosis of CEACAM-bound microorganisms such as Neisseria spp., Moraxella spp., and Haemophilus spp. This role places CEACAM3 at the forefront of pathogen clearance in the innate immune system. CEACAM3 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM3 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The CEACAM3 protein is a key granulocyte receptor that effectively orchestrates the opsonin-independent phagocytosis of CEACAM-bound microorganisms such as Neisseria spp., Moraxella spp., and Haemophilus spp. This role places CEACAM3 at the forefront of pathogen clearance in the innate immune system. CEACAM3 Protein, Human (HEK293, His) is the recombinant human-derived CEACAM3 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
CEACAM3 Protein emerges as a pivotal granulocyte receptor that orchestrates the efficient opsonin-independent phagocytosis of CEACAM-binding microorganisms, encompassing pathogens such as Neisseria, Moraxella, and Haemophilus species. This significant role positions CEACAM3 at the forefront of pathogen clearance within the innate immune system. In the course of pathogen phagocytosis, CEACAM3 takes on the responsibility of stimulating RAC1, further contributing to the cellular processes involved in pathogen engulfment. Notably, CEACAM3 engages in a calcium-dependent interaction with S100A9/calprotectin, a dynamic interaction that occurs independently of CEACAM3 phosphorylation. This intricate network of functions underscores the multifaceted role of CEACAM3 in orchestrating effective immune responses against a spectrum of microorganisms.
Verified Bioactivity
Immobilized Human CEACAM3 at 2 μg/mL (100 μL/well) can bind Biotinylated Human CEACAM7 Protein, the ED50 for this effect is 1.910 μg/mL.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
-
Bioactivity - ELISA
Bioactivity - ELISA
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
P40198 (K35-G155)
-
Molecular Construction
-
N-term
-
CEACAM3 (K35-G155)
Accession # P40198 -
6*His
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CEACAM3; CD66d Antigen; Prev. CGM1; Carcinoembryonic Antigen-Related Cell Adhesion Molecule 3, Isoform CRA_c; CD66d; Carcinoembryonic Antigen Gene Family Member 1; CGM1a; Nonspecific Cross-Reacting Antigen; Carcinoembryonic Antigen-Related Cell Adhesion M
-
AA Sequence
KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAG
-
Predicted Molecular Mass
13.9 kDa
-
Molecular Weight
Approximately 15-30 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.2.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
