1. Recombinant Proteins
  2. CD Antigens Receptor Proteins Biotinylated Proteins
  3. Stem Cell CD Proteins Epithelial cell CD Proteins Cell Adhesion Molecules (CAMs)
  4. CD66e/CEACAM5 Immunoglobulin-like Cell Adhesion Molecules
  5. CEACAM5 Protein, Human (Biotinylated, HEK293, His-Avi)

CEACAM5 Protein, Human (Biotinylated, HEK293, His-Avi)

Cat. No.: HY-P72362
Handling Instructions Technical Support

CEACAM5 protein is a cell surface glycoprotein that cooperates with carcinoembryonic antigen-related molecules (such as CEACAM6) to participate in cell adhesion, intracellular signaling, and tumor progression. CEACAM5 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CEACAM5 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

CEACAM5 protein is a cell surface glycoprotein that cooperates with carcinoembryonic antigen-related molecules (such as CEACAM6) to participate in cell adhesion, intracellular signaling, and tumor progression. CEACAM5 Protein, Human (Biotinylated, HEK293, His-Avi) is the recombinant human-derived CEACAM5 protein, expressed by HEK293 , with C-Avi, C-6*His labeled tag.

Background

CEACAM5 protein, a cell surface glycoprotein, assumes a multifaceted role in cell adhesion, intracellular signaling, and tumor progression. Functioning as a mediator of both homophilic and heterophilic cell adhesion, CEACAM5 interacts with other carcinoembryonic antigen-related cell adhesion molecules, such as CEACAM6. In the context of tumor progression, CEACAM5 acts as an oncogene, promoting tumor advancement and inducing resistance to anoikis in colorectal carcinoma cells. Additionally, during microbial infection, CEACAM5 serves as a receptor for E. coli Dr adhesins, and the binding of these adhesins results in the dissociation of the CEACAM5 homodimer. These diverse functions underscore the versatility of CEACAM5 in regulating cellular processes and highlight its significance in both physiological and pathological contexts.

Species

Human

Source

HEK293

Tag

C-Avi;C-6*His

Accession

P06731-1 (K35-A685)

Gene ID
Molecular Construction
N-term
CEACAM5 (K35-A685)
Accession # P06731-1
6*His-Avi
C-term
Protein Length

Full Length of Mature Protein

Conjugation

Biotin

Conjugate Method

The single lysine residue in Avitag is biotinylated through an enzymatic reaction.

Synonyms
Carcinoembryonic antigen; CEA; Meconium antigen 100; CD66e
AA Sequence

KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNKLSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSA

Molecular Weight

110-150 kDa

Glycosylation
Yes
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CEACAM5 Protein, Human (Biotinylated, HEK293, His-Avi)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CEACAM5 Protein, Human (Biotinylated, HEK293, His-Avi)
Cat. No.:
HY-P72362
Quantity:
MCE Japan Authorized Agent: