CEACAM7 Protein, Human (207a.a, HEK293, His)

Customer Review

Based on 1 Customer Validation

Carcinoembryonic antigen-related cell adhesion molecule 7 is a member of the CEA family, a large group of proteins with diverse roles, and which are typically dysregulated in malignancies. Carcinoembryonic antigen-related cell adhesion molecule 7 is a GPI-anchored protein with no intracellular domain and a relatively small extracellular domain.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Carcinoembryonic antigen-related cell adhesion molecule 7 is a member of the CEA family, a large group of proteins with diverse roles, and which are typically dysregulated in malignancies. Carcinoembryonic antigen-related cell adhesion molecule 7 is a GPI-anchored protein with no intracellular domain and a relatively small extracellular domain.

Background

Carcinoembryonic antigen-related cell adhesion molecule 7 encodes a cell surface glycoprotein and member of the carcinoembryonic antigen (CEA) family of proteins. Expression of this gene may be downregulated in colon and rectal cancer. Carcinoembryonic antigen-related cell adhesion molecule 7 with lower expression levels may be predictive of rectal cancer recurrence. Carcinoembryonic antigen-related cell adhesion molecule 7 is present in a CEA family gene cluster on chromosome 19[1][2][3].

Verified Bioactivity

Immobilized Human CEACAM-7, His Tag at 2 μg/mL (100 μL/well) on the plate. Dose response curve for Human CEACAM-3, hFc Tag with the EC50 of 17.8 ng/mL determined by ELISA.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CEACAM7 (T36-S242)
      Accession # Q14002-1
    • His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    CEACAM7; Carcinoembryonic Antigen Gene Family Member 2; Prev. CGM2; Carcinoembryonic Antigen CGM2; Carcinoembryonic Antigen-Related Cell Adhesion Molecule 7; CEA; Carcinoembryonic Antigen Related Cell Adhesion Molecule 7; CEA Cell Adhesion Molecule 7; Cel

  • AA Sequence

    TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGIYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGPYECEIQNPVGASRSDPVTLNVRYESVQAS

  • Predicted Molecular Mass

    24.5 kDa

  • Molecular Weight

    Approximately 45-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Purity

    ≥ 95%, as determined by Bis-Tris PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm solution of PBS, pH 7.4, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00