CEACAM7 Protein, Human (207a.a, HEK293, His)
Based on 1 Customer Validation
Carcinoembryonic antigen-related cell adhesion molecule 7 is a member of the CEA family, a large group of proteins with diverse roles, and which are typically dysregulated in malignancies. Carcinoembryonic antigen-related cell adhesion molecule 7 is a GPI-anchored protein with no intracellular domain and a relatively small extracellular domain.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Carcinoembryonic antigen-related cell adhesion molecule 7 is a member of the CEA family, a large group of proteins with diverse roles, and which are typically dysregulated in malignancies. Carcinoembryonic antigen-related cell adhesion molecule 7 is a GPI-anchored protein with no intracellular domain and a relatively small extracellular domain.
Background
Carcinoembryonic antigen-related cell adhesion molecule 7 encodes a cell surface glycoprotein and member of the carcinoembryonic antigen (CEA) family of proteins. Expression of this gene may be downregulated in colon and rectal cancer. Carcinoembryonic antigen-related cell adhesion molecule 7 with lower expression levels may be predictive of rectal cancer recurrence. Carcinoembryonic antigen-related cell adhesion molecule 7 is present in a CEA family gene cluster on chromosome 19[1][2][3].
Verified Bioactivity
Immobilized Human CEACAM-7, His Tag at 2 μg/mL (100 μL/well) on the plate. Dose response curve for Human CEACAM-3, hFc Tag with the EC50 of 17.8 ng/mL determined by ELISA.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His
-
Accession
Q14002-1 (T36-S242)
-
Gene ID1087
-
Molecular Construction
-
N-term
-
CEACAM7 (T36-S242)
Accession # Q14002-1 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CEACAM7; Carcinoembryonic Antigen Gene Family Member 2; Prev. CGM2; Carcinoembryonic Antigen CGM2; Carcinoembryonic Antigen-Related Cell Adhesion Molecule 7; CEA; Carcinoembryonic Antigen Related Cell Adhesion Molecule 7; CEA Cell Adhesion Molecule 7; Cel
-
AA Sequence
TNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHANYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGIYTLHVIKENLVNEEVTRQFYVFSEPPKPSITSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGPYECEIQNPVGASRSDPVTLNVRYESVQAS
-
Predicted Molecular Mass
24.5 kDa
-
Molecular Weight
Approximately 45-65 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by Bis-Tris PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm solution of PBS, pH 7.4, 8% trehalose.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
