CECR2 Protein, Human (His)

The CECR2 protein is a regulatory subunit in the CERF-1 and CERF-5 ISWI chromatin remodeling complexes that assembles ordered nucleosome arrays to help DNA enter replication, transcription, and repair. Despite lacking mononucleosome sliding ability, these complexes make crucial contributions to various developmental processes. CECR2 Protein, Human (His) is the recombinant human-derived CECR2 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The CECR2 protein is a regulatory subunit in the CERF-1 and CERF-5 ISWI chromatin remodeling complexes that assembles ordered nucleosome arrays to help DNA enter replication, transcription, and repair. Despite lacking mononucleosome sliding ability, these complexes make crucial contributions to various developmental processes. CECR2 Protein, Human (His) is the recombinant human-derived CECR2 protein, expressed by E. coli , with N-6*His labeled tag.

Background

CECR2 protein functions as a regulatory subunit within the ATP-dependent CERF-1 and CERF-5 ISWI chromatin remodeling complexes, which orchestrate the assembly of ordered nucleosome arrays on chromatin, facilitating DNA access during essential processes such as DNA replication, transcription, and repair. Despite lacking the capacity to slide mononucleosomes to the center of a DNA template, these complexes play crucial roles in various developmental processes. During embryogenesis, CECR2 is required for neural tube closure and inner ear development, while in adults, it is essential for spermatogenesis through the formation of ISWI-type chromatin complexes. Recognizing and binding acylated histones, CECR2 interacts with histones acetylated and/or butyrylated, contributing to histone-modifying complexes. Furthermore, its interaction with LRPPRC suggests involvement in integrating the cytoskeletal network with vesicular trafficking, nucleocytosolic shuttling, transcription, chromosome remodeling, and cytokinesis. As part of the CERF-1 and CERF-5 ISWI chromatin remodeling complexes, CECR2 collaborates with SMARCA1 and SMARCA5/SNF2H, respectively, highlighting its multifaceted role in chromatin dynamics and cellular processes.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • CECR2 (R425-H538)
      Accession # Q9BXF3
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CECR2; Cat Eye Syndrome Chromosome Region, Candidate 2; CECR2 Histone Acetyl-Lysine Reader; Cat Eye Syndrome Critical Region Protein 2; Chromatin Remodeling Regulator CECR2; Alternative Protein CECR2; KIAA1740

  • AA Sequence

    REEKKTKDLFELDDDFTAMYKVLDVVKAHKDSWPFLEPVDESYAPNYYQIIKAPMDISSMEKKLNGGLYCTKEEFVNDMKTMFRNCRKYNGESSEYTKMSDNLERCFHRAMMKH

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00