CECR2 Protein, Human (His)
The CECR2 protein is a regulatory subunit in the CERF-1 and CERF-5 ISWI chromatin remodeling complexes that assembles ordered nucleosome arrays to help DNA enter replication, transcription, and repair. Despite lacking mononucleosome sliding ability, these complexes make crucial contributions to various developmental processes. CECR2 Protein, Human (His) is the recombinant human-derived CECR2 protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The CECR2 protein is a regulatory subunit in the CERF-1 and CERF-5 ISWI chromatin remodeling complexes that assembles ordered nucleosome arrays to help DNA enter replication, transcription, and repair. Despite lacking mononucleosome sliding ability, these complexes make crucial contributions to various developmental processes. CECR2 Protein, Human (His) is the recombinant human-derived CECR2 protein, expressed by E. coli , with N-6*His labeled tag.
Background
CECR2 protein functions as a regulatory subunit within the ATP-dependent CERF-1 and CERF-5 ISWI chromatin remodeling complexes, which orchestrate the assembly of ordered nucleosome arrays on chromatin, facilitating DNA access during essential processes such as DNA replication, transcription, and repair. Despite lacking the capacity to slide mononucleosomes to the center of a DNA template, these complexes play crucial roles in various developmental processes. During embryogenesis, CECR2 is required for neural tube closure and inner ear development, while in adults, it is essential for spermatogenesis through the formation of ISWI-type chromatin complexes. Recognizing and binding acylated histones, CECR2 interacts with histones acetylated and/or butyrylated, contributing to histone-modifying complexes. Furthermore, its interaction with LRPPRC suggests involvement in integrating the cytoskeletal network with vesicular trafficking, nucleocytosolic shuttling, transcription, chromosome remodeling, and cytokinesis. As part of the CERF-1 and CERF-5 ISWI chromatin remodeling complexes, CECR2 collaborates with SMARCA1 and SMARCA5/SNF2H, respectively, highlighting its multifaceted role in chromatin dynamics and cellular processes.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q9BXF3 (R425-H538)
-
Gene ID27443
-
Molecular Construction
-
N-term
-
6*His
-
CECR2 (R425-H538)
Accession # Q9BXF3 -
C-term
-
-
Protein Length
Partial
-
Synonyms
CECR2; Cat Eye Syndrome Chromosome Region, Candidate 2; CECR2 Histone Acetyl-Lysine Reader; Cat Eye Syndrome Critical Region Protein 2; Chromatin Remodeling Regulator CECR2; Alternative Protein CECR2; KIAA1740
-
AA Sequence
REEKKTKDLFELDDDFTAMYKVLDVVKAHKDSWPFLEPVDESYAPNYYQIIKAPMDISSMEKKLNGGLYCTKEEFVNDMKTMFRNCRKYNGESSEYTKMSDNLERCFHRAMMKH
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)