1. Recombinant Proteins
  2. Others
  3. CECR2 Protein, Human (His)

The CECR2 protein is a regulatory subunit in the CERF-1 and CERF-5 ISWI chromatin remodeling complexes that assembles ordered nucleosome arrays to help DNA enter replication, transcription, and repair. Despite lacking mononucleosome sliding ability, these complexes make crucial contributions to various developmental processes. CECR2 Protein, Human (His) is the recombinant human-derived CECR2 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CECR2 protein is a regulatory subunit in the CERF-1 and CERF-5 ISWI chromatin remodeling complexes that assembles ordered nucleosome arrays to help DNA enter replication, transcription, and repair. Despite lacking mononucleosome sliding ability, these complexes make crucial contributions to various developmental processes. CECR2 Protein, Human (His) is the recombinant human-derived CECR2 protein, expressed by E. coli , with N-6*His labeled tag.

Background

CECR2 protein functions as a regulatory subunit within the ATP-dependent CERF-1 and CERF-5 ISWI chromatin remodeling complexes, which orchestrate the assembly of ordered nucleosome arrays on chromatin, facilitating DNA access during essential processes such as DNA replication, transcription, and repair. Despite lacking the capacity to slide mononucleosomes to the center of a DNA template, these complexes play crucial roles in various developmental processes. During embryogenesis, CECR2 is required for neural tube closure and inner ear development, while in adults, it is essential for spermatogenesis through the formation of ISWI-type chromatin complexes. Recognizing and binding acylated histones, CECR2 interacts with histones acetylated and/or butyrylated, contributing to histone-modifying complexes. Furthermore, its interaction with LRPPRC suggests involvement in integrating the cytoskeletal network with vesicular trafficking, nucleocytosolic shuttling, transcription, chromosome remodeling, and cytokinesis. As part of the CERF-1 and CERF-5 ISWI chromatin remodeling complexes, CECR2 collaborates with SMARCA1 and SMARCA5/SNF2H, respectively, highlighting its multifaceted role in chromatin dynamics and cellular processes.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q9BXF3 (R425-H538)

Gene ID

27443

Molecular Construction
N-term
6*His
CECR2 (R425-H538)
Accession # Q9BXF3
C-term
Protein Length

Partial

Synonyms
CECR2; Cat eye syndrome critical region protein 2
AA Sequence

REEKKTKDLFELDDDFTAMYKVLDVVKAHKDSWPFLEPVDESYAPNYYQIIKAPMDISSMEKKLNGGLYCTKEEFVNDMKTMFRNCRKYNGESSEYTKMSDNLERCFHRAMMKH

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CECR2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CECR2 Protein, Human (His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CECR2 Protein, Human (His)
Cat. No.:
HY-P701613
Quantity:
MCE Japan Authorized Agent: