CEP55 Protein, Human
CEP55 Protein, Human is the recombinant human-derived CEP55, expressed by E. coli , with tag Free labeled tag.
- Species: Human
- Source: E. coli
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
CEP55 Protein, Human is the recombinant human-derived CEP55, expressed by E. coli , with tag Free labeled tag.
CEP55 plays a crucial role in mitotic exit and cytokinesis. It recruits PDCD6IP and TSG101 to the midbody during cytokinesis, ensuring the successful completion of this process. While not required for microtubule nucleation, CEP55 is involved in the development of the brain and kidney.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q53EZ4-1 (A156-P217)
-
Gene ID55165
-
Protein Length
Partial
-
Synonyms
CEP55; Centrosomal Protein 55kDa; Prev. C10orf3; URCC6; Centrosomal Protein Of 55 KDa; Chromosome 10 Open Reading Frame 3; CT111; MARCH; Up-Regulated In Colon Cancer 6; Cep55; Cancer/Testis Antigen 111; Centrosomal Protein 55; FLJ10540
-
AA Sequence
APNCFNSSINNIHEMEIQLKDALEKNQQWLVYDQQREVYVKGLLAKIFELEKKTETAAHSLP
-
Predicted Molecular Mass
7.4 kDa
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
