CHAC1 Protein, Human (StrepⅡ)
Based on 1 Customer Validation
The CHAC1 protein cleaves glutathione, inducing apoptosis via the ATF4-ATF3-DDIT3/CHOP cascade. It acts as a negative regulator of the Notch signaling pathway, promoting neurogenesis by inhibiting Notch cleavage. CHAC1 Protein, Human is the recombinant human-derived CHAC1 protein, expressed by E. coli , with C-Strep.
- Species: Human
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Biological Activity
Description
The CHAC1 protein cleaves glutathione, inducing apoptosis via the ATF4-ATF3-DDIT3/CHOP cascade. It acts as a negative regulator of the Notch signaling pathway, promoting neurogenesis by inhibiting Notch cleavage. CHAC1 Protein, Human is the recombinant human-derived CHAC1 protein, expressed by E. coli , with C-Strep.
Background
CHAC1, a key player in cellular processes, catalyzes the cleavage of glutathione into 5-oxo-L-proline and a Cys-Gly dipeptide, exhibiting specificity for glutathione over other gamma-glutamyl peptides. Its enzymatic action on glutathione is crucial as glutathione depletion is a significant factor in apoptosis initiation and execution. CHAC1 further serves as a pro-apoptotic component within the unfolded protein response pathway, mediating the effects of the ATF4-ATF3-DDIT3/CHOP cascade. Additionally, CHAC1 functions as a negative regulator of the Notch signaling pathway, impacting embryonic neurogenesis by inhibiting Notch cleavage through furin. This inhibition maintains Notch in an immature, inactive form, thereby promoting neurogenesis in embryos.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-StrepⅡ
-
Accession
Q9BUX1 (K2-V222)
-
Gene ID79094
-
Molecular Construction
-
N-term
-
CHAC1 (K2-V222)
Accession # Q9BUX1 -
StrepⅡ
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
CHAC1; Botch; ChaC Glutathione Specific Gamma-Glutamylcyclotransferase 1; ChaC, Cation Transport Regulator Homolog 1 (E. Coli); Glutathione-Specific Gamma-Glutamylcyclotransferase 1; ChaC, Cation Transport Regulator Homolog 1; Gamma-GCT Acting On Glutathi
-
AA Sequence
KQESAAPNTPPTSQSPTPSAQFPRNDGDPQALWIFGYGSLVWRPDFAYSDSRVGFVRGYSRRFWQGDTFHRGSDKMPGRVVTLLEDHEGCTWGVAYQVQGEQVSKALKYLNVREAVLGGYDTKEVTFYPQDAPDQPLKALAYVATPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQDEHLAAIVDAVGTMLPCFCPTEQALALV
-
Predicted Molecular Mass
27.2 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (312 KB)
- English - EN (312 KB)
- Français - FR (312 KB)
- Deutsch - DE (312 KB)
- Norwegian - NO (312 KB)
- Español - ES (312 KB)
- Swedish - SV (312 KB)
- Italian - IT (312 KB)
- Korean - KR (312 KB)
- Portuguese - PT (312 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)