CHAC1 Protein, Human (StrepⅡ)

Customer Review

Based on 1 Customer Validation

The CHAC1 protein cleaves glutathione, inducing apoptosis via the ATF4-ATF3-DDIT3/CHOP cascade. It acts as a negative regulator of the Notch signaling pathway, promoting neurogenesis by inhibiting Notch cleavage. CHAC1 Protein, Human is the recombinant human-derived CHAC1 protein, expressed by E. coli , with C-Strep.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The CHAC1 protein cleaves glutathione, inducing apoptosis via the ATF4-ATF3-DDIT3/CHOP cascade. It acts as a negative regulator of the Notch signaling pathway, promoting neurogenesis by inhibiting Notch cleavage. CHAC1 Protein, Human is the recombinant human-derived CHAC1 protein, expressed by E. coli , with C-Strep.

Background

CHAC1, a key player in cellular processes, catalyzes the cleavage of glutathione into 5-oxo-L-proline and a Cys-Gly dipeptide, exhibiting specificity for glutathione over other gamma-glutamyl peptides. Its enzymatic action on glutathione is crucial as glutathione depletion is a significant factor in apoptosis initiation and execution. CHAC1 further serves as a pro-apoptotic component within the unfolded protein response pathway, mediating the effects of the ATF4-ATF3-DDIT3/CHOP cascade. Additionally, CHAC1 functions as a negative regulator of the Notch signaling pathway, impacting embryonic neurogenesis by inhibiting Notch cleavage through furin. This inhibition maintains Notch in an immature, inactive form, thereby promoting neurogenesis in embryos.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag C-StrepⅡ
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • CHAC1 (K2-V222)
      Accession # Q9BUX1
    • StrepⅡ
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    CHAC1; Botch; ChaC Glutathione Specific Gamma-Glutamylcyclotransferase 1; ChaC, Cation Transport Regulator Homolog 1 (E. Coli); Glutathione-Specific Gamma-Glutamylcyclotransferase 1; ChaC, Cation Transport Regulator Homolog 1; Gamma-GCT Acting On Glutathi

  • AA Sequence

    KQESAAPNTPPTSQSPTPSAQFPRNDGDPQALWIFGYGSLVWRPDFAYSDSRVGFVRGYSRRFWQGDTFHRGSDKMPGRVVTLLEDHEGCTWGVAYQVQGEQVSKALKYLNVREAVLGGYDTKEVTFYPQDAPDQPLKALAYVATPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQDEHLAAIVDAVGTMLPCFCPTEQALALV

  • Predicted Molecular Mass

    27.2 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution.

Formulation

Supplied as a 0.22 μm filtered solution of 50 mM HEPES, pH 7.5, 200 mM NaCl, 20% glycerol, 1 mM DTT.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

Please use rapid thawing with running water to thaw the protein.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00