Chymase/CMA1 Protein, Human (sf9, His)
Based on 1 Customer Validation
Chymase/CMA1 Protein, a secreted protease from mast cells, plays a significant role in generating vasoactive peptides, degrading the extracellular matrix, and regulating gland secretion. Chymase/CMA1 Protein, Human (sf9, His) is the recombinant human-derived Chymase/CMA1 protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Chymase/CMA1 Protein, a secreted protease from mast cells, plays a significant role in generating vasoactive peptides, degrading the extracellular matrix, and regulating gland secretion. Chymase/CMA1 Protein, Human (sf9, His) is the recombinant human-derived Chymase/CMA1 protein, expressed by Sf9 insect cells , with C-His labeled tag.
Background
Chymase/CMA1 protein is a significant secreted protease produced by mast cells, and it is believed to have various functions such as the generation of vasoactive peptides, degradation of the extracellular matrix, and regulation of gland secretion.
Verified Bioactivity
Measured by its ability to cleave the fluorogenic peptide substrate, SUC-Ala-Ala-Pro-Phe-AMC(HY-137811). The specific activity is 453.366 pmol/min/μg.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
P23946 (G20-N247)
-
Molecular Construction
-
N-term
-
CMA1 (G20-N247)
Accession # P23946 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CMA1; Chymase; Chymase 1; CYH; Chymase 1 Preproprotein Transcript E; Chymase, Mast Cell; Chymase 1 Preproprotein Transcript I; Chymase, Heart; Chymase 1, Mast Cell; MCT1; Mast Cell Protease I; CYM; Alpha-Chymase
-
AA Sequence
GEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN
-
Predicted Molecular Mass
26.6 kDa
-
Molecular Weight
Approximately 33 kDa, based on SDS-PAGE under reducing conditions.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris, 500 mM NaCl, pH 7.4, 10% glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
