Claudin-6/CLDN6 Protein-VLP, Human (HEK293, GFP, solution)
Claudin-6/CLDN6 Protein-VLP, Human (HEK293, GFP, solution) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P705433.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Claudin-6/CLDN6 Protein-VLP, Human (HEK293, GFP, solution) is recommended for animal immunization, ELISA. It is not recommended for receptor-ligand interaction detection and SPR/BLI assay since there are other irrelevant membrane proteins of the host on the VLP envelope, and the receptor-ligand interaction will have strong background interference. High requirements for chips and experimental protocols are needed for SPR/BLI assays. If VLP control is required, it is recommended HY-P705433.
Background
The Claudin-6/CLDN6 protein-VLP plays a crucial role in the specific obliteration of the intercellular space in tight junctions. It is involved in maintaining the integrity of the cell barrier, preventing leakage and maintaining cell polarity. Additionally, the protein acts as a receptor for hepatitis C virus (HCV) entry into hepatic cells, facilitating viral infection.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag Tag Free
-
Accession
P56747 (M1-V220)
-
Gene ID9074
-
Molecular Construction
-
N-term
-
CLDN6 (M1-V220)
Accession # P56747 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
CLDN6; Claudin-6; Claudin 6; Skullin
-
AA Sequence
MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV
-
Purity
Purity analysis by SDS-PAGE is not available for VLP proteins.
Product Properties
Solution
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
