1. Recombinant Proteins
  2. Others
  3. Claudin-6 Protein-Nanodisc, Human (HEK293, GFP, His)

Claudin-6 Protein-Nanodisc, Human (HEK293, GFP, His)

Cat. No.: HY-P703889
Handling Instructions Technical Support

Claudin-6/CLDN6 Protein-VLP is pivotal in targeted elimination of intercellular spaces within tight junctions, ensuring cell barrier integrity and polarity. Moreover, it serves as a receptor for hepatitis C virus (HCV), facilitating viral entry into hepatic cells. Claudin-6 Protein-Nanodisc, Human (HEK293, GFP, His) is the recombinant human-derived Claudin-6 protein, expressed by HEK293, with C-His and C-GFP labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Claudin-6/CLDN6 Protein-VLP is pivotal in targeted elimination of intercellular spaces within tight junctions, ensuring cell barrier integrity and polarity. Moreover, it serves as a receptor for hepatitis C virus (HCV), facilitating viral entry into hepatic cells. Claudin-6 Protein-Nanodisc, Human (HEK293, GFP, His) is the recombinant human-derived Claudin-6 protein, expressed by HEK293, with C-His and C-GFP labeled tag.

Background

The Claudin-6/CLDN6 protein-VLP plays a crucial role in the specific obliteration of the intercellular space in tight junctions. It is involved in maintaining the integrity of the cell barrier, preventing leakage and maintaining cell polarity. Additionally, the protein acts as a receptor for hepatitis C virus (HCV) entry into hepatic cells, facilitating viral infection.

Species

Human

Source

HEK293

Tag

C-His;C-GFP

Accession

P56747 (M1-V220)

Gene ID

9074

Protein Length

Full Length of Isoform-1

Synonyms
Claudin-6; Skullin; CLDN6; Claudin6; Skullin 2
AA Sequence

MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV

Predicted Molecular Mass
23.3 kDa
Molecular Weight

Approximately 37.2 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 85%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Claudin-6 Protein-Nanodisc, Human (HEK293, GFP, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Claudin-6 Protein-Nanodisc, Human (HEK293, GFP, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Claudin-6 Protein-Nanodisc, Human (HEK293, GFP, His)
Cat. No.:
HY-P703889
Quantity:
MCE Japan Authorized Agent: