Claudin-6 Protein-Nanodisc, Human (HEK293, GFP, His)
Claudin-6/CLDN6 Protein-VLP is pivotal in targeted elimination of intercellular spaces within tight junctions, ensuring cell barrier integrity and polarity. Moreover, it serves as a receptor for hepatitis C virus (HCV), facilitating viral entry into hepatic cells. Claudin-6 Protein-Nanodisc, Human (HEK293, GFP, His) is the recombinant human-derived Claudin-6 protein, expressed by HEK293, with C-His and C-GFP labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Claudin-6/CLDN6 Protein-VLP is pivotal in targeted elimination of intercellular spaces within tight junctions, ensuring cell barrier integrity and polarity. Moreover, it serves as a receptor for hepatitis C virus (HCV), facilitating viral entry into hepatic cells. Claudin-6 Protein-Nanodisc, Human (HEK293, GFP, His) is the recombinant human-derived Claudin-6 protein, expressed by HEK293, with C-His and C-GFP labeled tag.
Background
The Claudin-6/CLDN6 protein-VLP plays a crucial role in the specific obliteration of the intercellular space in tight junctions. It is involved in maintaining the integrity of the cell barrier, preventing leakage and maintaining cell polarity. Additionally, the protein acts as a receptor for hepatitis C virus (HCV) entry into hepatic cells, facilitating viral infection.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-His;C-GFP
-
Accession
P56747 (M1-V220)
-
Gene ID9074
-
Protein Length
Full Length
-
Synonyms
CLDN6; Claudin-6; Claudin 6; Skullin
-
AA Sequence
MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV
-
Predicted Molecular Mass
23.3 kDa
-
Molecular Weight
Approximately 37 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 85%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
