CLEC11A/SCGF-alpha Protein, Rat (HEK293, His)
Based on 1 Customer Validation
CLEC11A/SCGF-alpha Protein, Rat (HEK293, His) is the recombinant rat-derived CLEC11A/SCGF-alpha protein, expressed by HEK293, with C-His tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CLEC11A/SCGF-alpha Protein, Rat (HEK293, His) is the recombinant rat-derived CLEC11A/SCGF-alpha protein, expressed by HEK293, with C-His tag.
Background
CLEC11A/SCGF-alpha is a protein that promotes osteogenesis by stimulating the differentiation of mesenchymal progenitors into mature osteoblasts. It plays a crucial role in the repair and maintenance of adult bone.
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-8*His
-
Accession
O88201 (A22-F328)
-
Gene ID/
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CLEC11A; Lymphocyte Secreted C-Type Lectin; Prev. SCGF; Osteolectin; CLECSF3; C-Type (Calcium Dependent, Carbohydrate-Recognition Domain) Lectin, Superfamily Member 3; LSLCL; C-Type Lectin Domain Family 11, Member A, Isoform CRA_c; P47; Lymphocyte Secrete
-
AA Sequence
ARGHGKEWEGVWGGALEEERDRESLMLKNLQEALGLPTGVGNKDNLAENSEGKEVWEATETQGEEEEEETTTTPSSSPTPFPSPSPTSEDTVTYILGRLASLDAGLHQLHIRLHVLDTRVVELTQGLRRLRDAASDTRDSVQALKEVQVRSEQEHGRLEGCLKGLRLGHKCFLLSRDFETQAAAQARCKARGGSLAQPADRQQMDALSRYLRAALAPYNWPVWLGVHDRRSEGLYLFENGQRVSFFAWHRALSPESGAQPSAASHPLSPDQPNGGILENCVAQASDDGSWWDHDCERRLYFVCEFPF
-
Predicted Molecular Mass
35.8 kDa
-
Molecular Weight
Approximately 45-60 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
