CLEC3A Protein, Mouse (sf9, His)
CLEC3A protein plays a key role in promoting cell adhesion to laminin and fibronectin, indicating its crucial function in mediating cellular interactions with the extracellular matrix. This ability underscores its importance in regulating cell attachment, spreading, and signaling behaviors, contributing to the intricate network of molecular interactions governing cell-matrix interactions. CLEC3A Protein, Mouse (sf9, His) is the recombinant mouse-derived CLEC3A protein, expressed by Sf9 insect cells , with C-His labeled tag.
- Species: Mouse
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CLEC3A protein plays a key role in promoting cell adhesion to laminin and fibronectin, indicating its crucial function in mediating cellular interactions with the extracellular matrix. This ability underscores its importance in regulating cell attachment, spreading, and signaling behaviors, contributing to the intricate network of molecular interactions governing cell-matrix interactions. CLEC3A Protein, Mouse (sf9, His) is the recombinant mouse-derived CLEC3A protein, expressed by Sf9 insect cells , with C-His labeled tag.
Background
CLEC3A protein is instrumental in promoting cell adhesion to laminin and fibronectin. This suggests a pivotal role in mediating cellular interactions with the extracellular matrix, influencing processes such as cell attachment and spreading. The protein's ability to facilitate adhesion to specific components of the extracellular matrix highlights its importance in regulating cellular behaviors related to adhesion and signaling, contributing to the intricate network of molecular interactions that govern cell-matrix interactions.
Technical Parameters
-
Species Mouse
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
Q9EPW4 (Y23-P196)
-
Molecular Construction
-
N-term
-
CLEC3A (Y23-P196)
Accession # Q9EPW4 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CLEC3A; C-Type Lectin Domain Family 3, Member A; Prev. CLECSF1; C-Type Lectin Superfamily Member 1; C-Type (Calcium Dependent, Carbohydrate-Recognition Domain) Lectin, Superfamily Member 1 (Cartilage-Derived); Cartilage-Derived C-Type Lectin; C-Type Lecti
-
AA Sequence
YPSRMKARKHSKRRVKAKDDDLKSQVEKLWREVNALKEMQALQTVCLRGTKVHKKCYLASEGLKHYHEANEDCISKGGTLVVPRNSDEINALRDYGKRSLPGVNDFWLGINDMVTEGKFLDVHGFAVSFLNWDRAQPSGGKRENCVLFSQSAQGKWSDEACRSSKRYICEFIIP
-
Predicted Molecular Mass
21.3 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
