1. Recombinant Proteins
  2. Receptor Proteins
  3. Pattern Recognition Receptors
  4. C-type Lectin Receptors
  5. C-Type Lectin Domain Family 3 Member A (CLEC3A)
  6. CLEC3A Protein, Mouse (sf9, His)

CLEC3A protein plays a key role in promoting cell adhesion to laminin and fibronectin, indicating its crucial function in mediating cellular interactions with the extracellular matrix. This ability underscores its importance in regulating cell attachment, spreading, and signaling behaviors, contributing to the intricate network of molecular interactions governing cell-matrix interactions. CLEC3A Protein, Mouse (sf9, His) is the recombinant mouse-derived CLEC3A protein, expressed by Sf9 insect cells , with C-His labeled tag.

Para uso exclusivo en investigación. No vendemos a pacientes.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Tamaño Stock
50 μg   Obtener un presupuesto  
100 μg   Obtener un presupuesto  

* Seleccione Cantidad antes de agregar artículos.

Top Publications Citing Use of Products
  • Actividad biológica

  • Technical Parameters

  • Properties

  • Descripciòn

Descripciòn

CLEC3A protein plays a key role in promoting cell adhesion to laminin and fibronectin, indicating its crucial function in mediating cellular interactions with the extracellular matrix. This ability underscores its importance in regulating cell attachment, spreading, and signaling behaviors, contributing to the intricate network of molecular interactions governing cell-matrix interactions. CLEC3A Protein, Mouse (sf9, His) is the recombinant mouse-derived CLEC3A protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

CLEC3A protein is instrumental in promoting cell adhesion to laminin and fibronectin. This suggests a pivotal role in mediating cellular interactions with the extracellular matrix, influencing processes such as cell attachment and spreading. The protein's ability to facilitate adhesion to specific components of the extracellular matrix highlights its importance in regulating cellular behaviors related to adhesion and signaling, contributing to the intricate network of molecular interactions that govern cell-matrix interactions.

Species

Mouse

Source

Sf9 insect cells

Tag

C-His

Accession

Q9EPW4 (Y23-P196)

Gene ID
Molecular Construction
N-term
CLEC3A (Y23-P196)
Accession # Q9EPW4
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
C-type lectin domain family 3 member A; Cartilage-derived C-type lectin; Clecsf1; Gm796
AA Sequence

YPSRMKARKHSKRRVKAKDDDLKSQVEKLWREVNALKEMQALQTVCLRGTKVHKKCYLASEGLKHYHEANEDCISKGGTLVVPRNSDEINALRDYGKRSLPGVNDFWLGINDMVTEGKFLDVHGFAVSFLNWDRAQPSGGKRENCVLFSQSAQGKWSDEACRSSKRYICEFIIP

Predicted Molecular Mass
21.3 kDa
Pureza

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentación
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Productos vistos recientemente:

Consulta en línea

Your information is safe with us. * Required Fields.

CLEC3A Protein, Mouse (sf9, His)

 

Requested Quantity *

Nombre del solicitante *

 

Saludo

Direcciòn del E-mail *

 

Número de teléfono *

Department

 

Nombre de la Organizaciòn *

City

Provincia

Country or Region *

     

Observaciones

Consulta para venta a granel

Inquiry Information

Nombre del producto:
CLEC3A Protein, Mouse (sf9, His)
Cat. No.:
HY-P76832
Cantidad:
MCE Japan Authorized Agent: