CD300LF Protein, Rat (Myc, His-SUMO)
CMRF35-like molecule 1 (CLM-1) protein serves as an inhibitory receptor on myeloid cells and mast cells and is critical for immune homeostasis by regulating various immune responses. CLM-1 positively regulates macrophage-mediated endocytosis by recognizing phosphatidylserine on apoptotic cells. CD300LF Protein, Rat (Myc, His-SUMO) is the recombinant rat-derived CMRF35-like molecule 1 protein, expressed by E. coli , with N-His, C-Myc, N-SUMO labeled tag.
- Species: Rat
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
CMRF35-like molecule 1 (CLM-1) protein serves as an inhibitory receptor on myeloid cells and mast cells and is critical for immune homeostasis by regulating various immune responses. CLM-1 positively regulates macrophage-mediated endocytosis by recognizing phosphatidylserine on apoptotic cells. CD300LF Protein, Rat (Myc, His-SUMO) is the recombinant rat-derived CMRF35-like molecule 1 protein, expressed by E. coli , with N-His, C-Myc, N-SUMO labeled tag.
Background
CMRF35-like molecule 1 (CLM-1) protein serves as an inhibitory receptor for myeloid cells and mast cells, playing a crucial role in immune homeostasis by modulating various immune responses. CLM-1 positively regulates the phagocytosis of apoptotic cells, known as efferocytosis, through the recognition and binding of phosphatidylserine (PS) on the surface of apoptotic cells. This activity promotes macrophage-mediated efferocytosis while inhibiting dendritic cell-mediated efferocytosis. Furthermore, CLM-1 negatively regulates Fc epsilon receptor-dependent mast cell activation and allergic responses by binding to ceramide and sphingomyelin as ligands. It may also function as a coreceptor for interleukin 4 (IL-4), interacting with and regulating IL-4 receptor alpha-mediated responses, thereby augmenting IL-4- and IL-13-induced signaling. In addition, CLM-1 negatively regulates Toll-like receptor (TLR) signaling by activating phosphatases PTPN6/SHP-1 and PTPN11/SHP-2. Beyond its immunomodulatory functions, CLM-1 inhibits osteoclast formation and induces macrophage cell death upon engagement. The protein interacts with PTPN6/SHP-1 in a tyrosine phosphorylation-dependent manner and associates with IL4R.
Technical Parameters
-
Species Rat
-
Source E. coli
-
Tag N-His;C-Myc;N-SUMO
-
Accession
Q566E6 (A19-S181)
-
Molecular Construction
-
N-term
-
10*His-SUMO
-
CMRF35-like molecule 1 (A19-S181)
Accession # Q566E6 -
Myc
-
C-term
-
-
Protein Length
Extracellular Domain
-
Synonyms
CD300LF; NK Inhibitory Receptor; CD300 Molecule Like Family Member F; IREM-1; IGSF13; CLM-1; IREM1; CD300 Molecule-Like Family Member F; NKIR; CD300 Antigen Like Family Member F; CLM1; Immunoglobin Superfamily Member 13; CD300f; Inhibitory Receptor IREM1;
-
AA Sequence
AQDPVTGPEEVSGYEQGSLTVWCRYGSWWKDYSKYWCRGPKRSSCEIRVETDASERLVKENHVSIRDDQTNFTFTVTMEDLRMSDAGIYWCGITKAGYDHMFKVHVSINPVPTTPTTTSTTTIFTVTTTVKETSTLSTQTSHYSDNRYDSGGVGDGNGFLDLS
-
Predicted Molecular Mass
38.3 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)