CD300LF Protein, Rat (Myc, His-SUMO)

CMRF35-like molecule 1 (CLM-1) protein serves as an inhibitory receptor on myeloid cells and mast cells and is critical for immune homeostasis by regulating various immune responses. CLM-1 positively regulates macrophage-mediated endocytosis by recognizing phosphatidylserine on apoptotic cells. CD300LF Protein, Rat (Myc, His-SUMO) is the recombinant rat-derived CMRF35-like molecule 1 protein, expressed by E. coli , with N-His, C-Myc, N-SUMO labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

CMRF35-like molecule 1 (CLM-1) protein serves as an inhibitory receptor on myeloid cells and mast cells and is critical for immune homeostasis by regulating various immune responses. CLM-1 positively regulates macrophage-mediated endocytosis by recognizing phosphatidylserine on apoptotic cells. CD300LF Protein, Rat (Myc, His-SUMO) is the recombinant rat-derived CMRF35-like molecule 1 protein, expressed by E. coli , with N-His, C-Myc, N-SUMO labeled tag.

Background

CMRF35-like molecule 1 (CLM-1) protein serves as an inhibitory receptor for myeloid cells and mast cells, playing a crucial role in immune homeostasis by modulating various immune responses. CLM-1 positively regulates the phagocytosis of apoptotic cells, known as efferocytosis, through the recognition and binding of phosphatidylserine (PS) on the surface of apoptotic cells. This activity promotes macrophage-mediated efferocytosis while inhibiting dendritic cell-mediated efferocytosis. Furthermore, CLM-1 negatively regulates Fc epsilon receptor-dependent mast cell activation and allergic responses by binding to ceramide and sphingomyelin as ligands. It may also function as a coreceptor for interleukin 4 (IL-4), interacting with and regulating IL-4 receptor alpha-mediated responses, thereby augmenting IL-4- and IL-13-induced signaling. In addition, CLM-1 negatively regulates Toll-like receptor (TLR) signaling by activating phosphatases PTPN6/SHP-1 and PTPN11/SHP-2. Beyond its immunomodulatory functions, CLM-1 inhibits osteoclast formation and induces macrophage cell death upon engagement. The protein interacts with PTPN6/SHP-1 in a tyrosine phosphorylation-dependent manner and associates with IL4R.

Technical Parameters

  • Species Rat
  • Source E. coli
  • Tag N-His;C-Myc;N-SUMO
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 10*His-SUMO
    • CMRF35-like molecule 1 (A19-S181)
      Accession # Q566E6
    • Myc
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    CD300LF; NK Inhibitory Receptor; CD300 Molecule Like Family Member F; IREM-1; IGSF13; CLM-1; IREM1; CD300 Molecule-Like Family Member F; NKIR; CD300 Antigen Like Family Member F; CLM1; Immunoglobin Superfamily Member 13; CD300f; Inhibitory Receptor IREM1;

  • AA Sequence

    AQDPVTGPEEVSGYEQGSLTVWCRYGSWWKDYSKYWCRGPKRSSCEIRVETDASERLVKENHVSIRDDQTNFTFTVTMEDLRMSDAGIYWCGITKAGYDHMFKVHVSINPVPTTPTTTSTTTIFTVTTTVKETSTLSTQTSHYSDNRYDSGGVGDGNGFLDLS

  • Predicted Molecular Mass

    38.3 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00