Coagulation Factor III/F3 Protein, Canine (HEK293, His)
Coagulation Factor III (F3), or Tissue Factor (TF), initiates blood coagulation by forming a complex with circulating factor VII or VIIa. The [TF:VIIa] complex critically activates factors IX or X through limited proteolysis, initiating the coagulation cascade on the cell surface. F3's interaction with HSPE, inhibited by heparin, promotes the generation of activated factor X, emphasizing its central role in regulating hemostatic processes. Coagulation Factor III/F3 Protein, Canine (HEK293, His) is the recombinant canine-derived Coagulation Factor III/F3 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Canine
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
Coagulation Factor III (F3), or Tissue Factor (TF), initiates blood coagulation by forming a complex with circulating factor VII or VIIa. The [TF:VIIa] complex critically activates factors IX or X through limited proteolysis, initiating the coagulation cascade on the cell surface. F3's interaction with HSPE, inhibited by heparin, promotes the generation of activated factor X, emphasizing its central role in regulating hemostatic processes. Coagulation Factor III/F3 Protein, Canine (HEK293, His) is the recombinant canine-derived Coagulation Factor III/F3 protein, expressed by HEK293 , with C-His labeled tag.
Background
Coagulation Factor III (F3), also known as Tissue Factor (TF), serves as a pivotal initiator of blood coagulation through the formation of a complex with circulating factor VII or VIIa. This [TF:VIIa] complex plays a critical role in activating factors IX or X through specific limited proteolysis, thereby initiating the assembly and propagation of the coagulation protease cascade on the cell surface. Notably, F3 interacts with HSPE, and heparin inhibits this interaction. The interplay between F3 and HSPE promotes the generation of activated factor X and activates coagulation in the presence of activated factor VII, emphasizing F3's central involvement in the regulation of hemostatic processes.
Technical Parameters
-
Species Canine
-
Source HEK293
-
Tag C-8*His
-
Accession
Q4W6L5 (T35-E248)
-
Molecular Construction
-
N-term
-
F3 (T35-E248)
Accession # Q4W6L5 -
8*His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
F3; Coagulation Factor III (Thromboplastin, Tissue Factor); Coagulation Factor III, Tissue Factor; Coagulation Factor III; TF; Thromboplastin; Tissue Factor; CD142 Antigen; CD142; TFA
-
AA Sequence
TADVVVAYNLTWKSTNFKTILEWEPKPINHVYTVQISPRLGNWKSKCFYTTDTECDLTDEIVNDVHQTYQARVFSYPADATDYSGEPPFTNSPEFIPYIETKLGQPTIQSFKQVGTELNVIVQDARTLVKVNGTFLSLRDVFGKDLSYTLYYWKASSTGKKTAKTNTNEFLIDVDEGQNYCFSVQAGIPSRKANQKSPESPIECTSHEKGMFRE
-
Predicted Molecular Mass
25.4 kDa
-
Molecular Weight
Approximately 35-45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
