1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Coagulation Factor III/F3 Protein, Canine (HEK293, His)

Coagulation Factor III/F3 Protein, Canine (HEK293, His)

Cat. No.: HY-P700695
Handling Instructions Technical Support

Coagulation Factor III (F3), or Tissue Factor (TF), initiates blood coagulation by forming a complex with circulating factor VII or VIIa. The [TF:VIIa] complex critically activates factors IX or X through limited proteolysis, initiating the coagulation cascade on the cell surface. F3's interaction with HSPE, inhibited by heparin, promotes the generation of activated factor X, emphasizing its central role in regulating hemostatic processes. Coagulation Factor III/F3 Protein, Canine (HEK293, His) is the recombinant canine-derived Coagulation Factor III/F3 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Coagulation Factor III (F3), or Tissue Factor (TF), initiates blood coagulation by forming a complex with circulating factor VII or VIIa. The [TF:VIIa] complex critically activates factors IX or X through limited proteolysis, initiating the coagulation cascade on the cell surface. F3's interaction with HSPE, inhibited by heparin, promotes the generation of activated factor X, emphasizing its central role in regulating hemostatic processes. Coagulation Factor III/F3 Protein, Canine (HEK293, His) is the recombinant canine-derived Coagulation Factor III/F3 protein, expressed by HEK293 , with C-His labeled tag.

Background

Coagulation Factor III (F3), also known as Tissue Factor (TF), serves as a pivotal initiator of blood coagulation through the formation of a complex with circulating factor VII or VIIa. This [TF:VIIa] complex plays a critical role in activating factors IX or X through specific limited proteolysis, thereby initiating the assembly and propagation of the coagulation protease cascade on the cell surface. Notably, F3 interacts with HSPE, and heparin inhibits this interaction. The interplay between F3 and HSPE promotes the generation of activated factor X and activates coagulation in the presence of activated factor VII, emphasizing F3's central involvement in the regulation of hemostatic processes.

Species

Canine

Source

HEK293

Tag

C-8*His

Accession

Q4W6L5 (T35-E248)

Gene ID
Molecular Construction
N-term
F3 (T35-E248)
Accession # Q4W6L5
8*His
C-term
Protein Length

Partial

Synonyms
Tissue factor; Coagulation Factor III; TF; Thromboplastin; CD142; F3; FLJ17960; TFA
AA Sequence

TADVVVAYNLTWKSTNFKTILEWEPKPINHVYTVQISPRLGNWKSKCFYTTDTECDLTDEIVNDVHQTYQARVFSYPADATDYSGEPPFTNSPEFIPYIETKLGQPTIQSFKQVGTELNVIVQDARTLVKVNGTFLSLRDVFGKDLSYTLYYWKASSTGKKTAKTNTNEFLIDVDEGQNYCFSVQAGIPSRKANQKSPESPIECTSHEKGMFRE

Predicted Molecular Mass
25.4 kDa
Molecular Weight

Approximately 35-45 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Coagulation Factor III/F3 Protein, Canine (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Coagulation Factor III/F3 Protein, Canine (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Coagulation Factor III/F3 Protein, Canine (HEK293, His)
Cat. No.:
HY-P700695
Quantity:
MCE Japan Authorized Agent: