COL4A1 Protein, Human (His)
Based on 1 Customer Validation
COL4A1 protein is an important type IV collagen component that forms the main structural framework of the glomerular basement membrane (GBM) with a unique "chicken wire" mesh structure. It cooperates with laminin, proteoglycans and nestin/nesidin to maintain the structural integrity of GBM. COL4A1 Protein, Human (His) is the recombinant human-derived COL4A1 protein, expressed by E. coli, with C-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
COL4A1 protein is an important type IV collagen component that forms the main structural framework of the glomerular basement membrane (GBM) with a unique "chicken wire" mesh structure. It cooperates with laminin, proteoglycans and nestin/nesidin to maintain the structural integrity of GBM. COL4A1 Protein, Human (His) is the recombinant human-derived COL4A1 protein, expressed by E. coli, with C-His labeled tag.
COL4A1 protein, a pivotal component of Type IV collagen, constitutes the primary structural framework of glomerular basement membranes (GBM), forming a distinctive 'chicken-wire' meshwork in collaboration with laminins, proteoglycans, and entactin/nidogen. Additionally, Arresten, consisting of the C-terminal NC1 domain of COL4A1, exerts a potent inhibitory effect on angiogenesis and tumor formation. Notably, the anti-angiogenic activity resides in the C-terminal half of COL4A1, where it selectively hampers endothelial cell proliferation, migration, and tube formation. This dual role of COL4A1 highlights its significance not only in maintaining the structural integrity of GBMs but also in modulating crucial processes such as angiogenesis and tumor development through the activity of Arresten.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag C-His
-
Accession
P02462 (G30-P167)
-
Gene ID1282
-
Protein Length
Partial
-
Synonyms
COL4A1; COL4A1 Protein; Collagen Type IV Alpha 1 Chain; Arresten; Collagen Alpha-1(IV) Chain; COL4A1s; Collagen Of Basement Membrane, Alpha-1 Chain; PADMAL; Collagen IV, Alpha-1 Polypeptide; BSVD1; Collagen, Type IV, Alpha 1; RATOR; COL4A1 NC1 Domain; BSV
-
AA Sequence
GCAGSGCGKCDCHGVKGQKGERGLPGLQGVIGFPGMQGPEGPQGPPGQKGDTGEPGLPGTKGTRGPPGASGYPGNPGLPGIPGQDGPPGPPGIPGCNGTKGERGPLGPPGLPGFAGNPGPPGLPGMKGDPGEILGHVP
-
Predicted Molecular Mass
19.8 kDa
-
Molecular Weight
Approximately 25 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
Lyophilized from a 0.22 μm filtered solution of PBS, 6% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
