Complement C5a Protein, Mouse (Biotinylated)
Complement C5/C5a Protein activates late complement components to form the membrane attack complex, C5-C9. C5b binds C6, initiating lytic complex assembly. C5a, produced by C5 degradation, acts as an anaphylatoxin, inducing local inflammation. C5a stimulates intracellular calcium release, smooth muscle contraction, vascular permeability, histamine release, and acts as a chemokine, guiding leukocyte migration. Complement C5a Protein, Mouse (Biotinylated) is the recombinant mouse-derived Complement C5/C5a protein, expressed by E. coli , with tag free.
- Species: Mouse
- Source: E. coli
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biologische Aktivität
-
Product Properties
- Documentation
- Help & FAQs
Biologische Aktivität
Complement C5/C5a Protein activates late complement components to form the membrane attack complex, C5-C9. C5b binds C6, initiating lytic complex assembly. C5a, produced by C5 degradation, acts as an anaphylatoxin, inducing local inflammation. C5a stimulates intracellular calcium release, smooth muscle contraction, vascular permeability, histamine release, and acts as a chemokine, guiding leukocyte migration. Complement C5a Protein, Mouse (Biotinylated) is the recombinant mouse-derived Complement C5/C5a protein, expressed by E. coli , with tag free.
Complement C5/C5a Protein, when activated by a C5 convertase, triggers the spontaneous assembly of the late complement components into the membrane attack complex, C5-C9. C5b forms a transient binding site for C6, forming the foundation for the assembly of the lytic complex. Meanwhile, C5a, produced through proteolytic degradation of complement C5, acts as an anaphylatoxin mediating local inflammatory processes. Its binding to the receptor C5AR1 induces various responses such as intracellular calcium release, smooth muscle contraction, increased vascular permeability, and histamine release from mast cells and basophilic leukocytes. Additionally, C5a acts as a potent chemokine, stimulating the movement of polymorphonuclear leukocytes and guiding their migration towards inflamed areas.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag Tag Free
-
Accession
P06684 (N679-R755)
-
Molecular Construction
-
N-term
-
C5a (N679-R755)
Accession # P06684 -
C-term
-
-
Protein Length
Partial
-
Synonyms
Complement C5; Hemolytic Complement; C5a
-
AA Sequence
NLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECCTIANKIRKESPHKPVQLGR
-
Predicted Molecular Mass
9 kDa
-
Reinheit
≥ 95%, as determined by reducing SDS-PAGE.
Documentation
Calculators
Konzentration (Stammlösung) × Volumen (Stammlösung) = Konzentration (Ziellösung) × Volumen (Ziellösung)
Powered by Bioz
