1. Recombinant Proteins
  2. Complement System Biotinylated Proteins
  3. Complement Component 5
  4. Complement Component 5a
  5. Complement C5a Protein, Mouse (Biotinylated)

Complement C5/C5a Protein activates late complement components to form the membrane attack complex, C5-C9. C5b binds C6, initiating lytic complex assembly. C5a, produced by C5 degradation, acts as an anaphylatoxin, inducing local inflammation. C5a stimulates intracellular calcium release, smooth muscle contraction, vascular permeability, histamine release, and acts as a chemokine, guiding leukocyte migration. Complement C5a Protein, Mouse (Biotinylated) is the recombinant mouse-derived Complement C5/C5a protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Complement C5/C5a Protein activates late complement components to form the membrane attack complex, C5-C9. C5b binds C6, initiating lytic complex assembly. C5a, produced by C5 degradation, acts as an anaphylatoxin, inducing local inflammation. C5a stimulates intracellular calcium release, smooth muscle contraction, vascular permeability, histamine release, and acts as a chemokine, guiding leukocyte migration. Complement C5a Protein, Mouse (Biotinylated) is the recombinant mouse-derived Complement C5/C5a protein, expressed by E. coli , with tag free.

Background

Complement C5/C5a Protein, when activated by a C5 convertase, triggers the spontaneous assembly of the late complement components into the membrane attack complex, C5-C9. C5b forms a transient binding site for C6, forming the foundation for the assembly of the lytic complex. Meanwhile, C5a, produced through proteolytic degradation of complement C5, acts as an anaphylatoxin mediating local inflammatory processes. Its binding to the receptor C5AR1 induces various responses such as intracellular calcium release, smooth muscle contraction, increased vascular permeability, and histamine release from mast cells and basophilic leukocytes. Additionally, C5a acts as a potent chemokine, stimulating the movement of polymorphonuclear leukocytes and guiding their migration towards inflamed areas.

Species

Mouse

Source

E. coli

Tag

Tag Free

Accession

P06684 (N679-R755)

Gene ID
Molecular Construction
N-term
C5a (N679-R755)
Accession # P06684
C-term
Protein Length

Partial

Conjugation

Biotin

Synonyms
Complement C5; Hemolytic Complement; C5a
AA Sequence

NLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIRAFNECCTIANKIRKESPHKPVQLGR

Predicted Molecular Mass
9 kDa
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Complement C5a Protein, Mouse (Biotinylated) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Complement C5a Protein, Mouse (Biotinylated)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Complement C5a Protein, Mouse (Biotinylated)
Cat. No.:
HY-P77540
Quantity:
MCE Japan Authorized Agent: