COQ7 Protein, Human (HEK293, His)
Based on 1 Customer Validation
The COQ7 protein is a key enzyme in lipid A biosynthesis and catalyzes a key hydrolysis step involving UDP-3-O-myristoyl-N-acetylglucosamine. This activity leads to the formation of UDP-3-O-myristoylglucosamine and acetate, which is a decisive point in lipid A synthesis. COQ7 Protein, Human (HEK293, His) is the recombinant human-derived COQ7 protein, expressed by HEK293 , with C-6*His labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The COQ7 protein is a key enzyme in lipid A biosynthesis and catalyzes a key hydrolysis step involving UDP-3-O-myristoyl-N-acetylglucosamine. This activity leads to the formation of UDP-3-O-myristoylglucosamine and acetate, which is a decisive point in lipid A synthesis. COQ7 Protein, Human (HEK293, His) is the recombinant human-derived COQ7 protein, expressed by HEK293 , with C-6*His labeled tag.
Background
LpxC protein plays a pivotal role in lipid A biosynthesis by catalyzing the crucial and committed step involving the hydrolysis of UDP-3-O-myristoyl-N-acetylglucosamine. This enzymatic activity leads to the formation of UDP-3-O-myristoylglucosamine and acetate, marking a decisive point in the intricate process of lipid A synthesis. The ability of LpxC to precisely modulate this step underscores its significance in the regulation of lipid A production, a crucial component of bacterial lipopolysaccharides with implications for membrane integrity and pathogenicity.
Verified Bioactivity
Measured by its ablity of the fluorescence loss after oxidation NADH to NAD+. The specific activity is 73.920 pmol/min/mg in the presence of 250 μM NADH and 250 μM DMQ0 at 30℃.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Assay Procedure
Materials
Experimental buffer: 20 mM HEPES, pH 7.6, 200 mM NaCl
Test Protein: COQ7 Protein, Human (HEK293, His) (HY-P70096)
Substrate: DMQ0
NADH
Procedure
1. Dilute COQ7 to 1000 ng/μL in the experimental buffer.
2. Mixing solution: A mixture containing 250 μM NADH and 250 μM DMQ0 in the experimental buffer.
3. Experimental group: 50 μL COQ7 protein + 50 μL mixture.
Blank group: 50 μL experimental buffer + 50 μL mixture.
4. Dilute the standards to 0, 4.8, 48, 97.5, 195, and 390 pmol, and measure at wavelengths of 340 and 445 nm.
5. Calculate the specific activity.
| Specific Activity (pmol/min/μg) = |
Adjusted Vmax* (RFU/min) × Conversion Factor** (pmol/RFU)
amount of enzyme (μg)
|
*Adjusted for Control
**Derived using calibration standard
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-6*His
-
Accession
Q99807-1 (S37-L217)
-
Molecular Construction
-
N-term
-
COQ7 (S37-L217)
Accession # Q99807 -
6*His
-
C-term
-
-
Protein Length
Full Length of Isoform-1
-
Synonyms
COQ7; Ubiquinone Biosynthesis Protein COQ7 Homolog; Coenzyme Q7, Hydroxylase; Coenzyme Q Biosynthesis Protein 7 Homolog; Ubiquinone Biosynthesis Monooxygenase COQ7; Coenzyme Q7 Homolog, Ubiquinone (Yeast); Timing Protein Clk-1 Homolog; COQ7 Coenzyme Q, 7
-
AA Sequence
SGMTLDNISRAAVDRIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKDHLKKFNELMVTFRVRPTVLMPLWNVLGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDIGLDHDAELAPAYAVLKSIIQAGCRVAIYLSERL
-
Molecular Weight
Approximately 18-29 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (261 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
