Cornulin Protein, Human (His)
Cornulin protein is critical in cell dynamics, promoting proliferation and promoting G1/S cell cycle progression, inducing the key regulator CCND1. It actively participates in the NFKB1 and PI3K/AKT pathways and responds to pro-inflammatory cytokines. Cornulin Protein, Human (His) is the recombinant human-derived Cornulin protein, expressed by E. coli , with N-6*His labeled tag.
- Species: Human
- Source: E. coli
Biological Activity
Cornulin protein is critical in cell dynamics, promoting proliferation and promoting G1/S cell cycle progression, inducing the key regulator CCND1. It actively participates in the NFKB1 and PI3K/AKT pathways and responds to pro-inflammatory cytokines. Cornulin Protein, Human (His) is the recombinant human-derived Cornulin protein, expressed by E. coli , with N-6*His labeled tag.
Cornulin Protein takes on a pivotal role in cellular dynamics by promoting cell proliferation and facilitating G1/S cell cycle progression. Its influence extends to the induction of CCND1, a crucial cell cycle regulator. Furthermore, Cornulin orchestrates the regulation of proliferation in response to pro-inflammatory cytokines, actively engaging the NFKB1 and PI3K/AKT signaling pathways. Operating as a homodimer, Cornulin emerges as a multifaceted player in cellular processes, contributing to the intricate balance of cell cycle control and response to inflammatory cues. The orchestrated interplay of Cornulin in these pathways underscores its significance in regulating cellular proliferation and highlights its potential implications in physiological and pathological contexts. Further exploration is warranted to comprehensively understand the specific molecular mechanisms underlying Cornulin's intricate involvement in cell cycle regulation and its responsiveness to pro-inflammatory stimuli.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-6*His
-
Accession
Q9UBG3 (M1-S140)
-
Molecular Construction
-
N-term
-
6*His
-
Cornulin (M1-S140)
Accession # Q9UBG3 -
C-term
-
-
Protein Length
Partial
-
Synonyms
CRNN; 53 KDa Putative Calcium-Binding Protein; Prev. C1orf10; Tumor-Related Protein; SEP53; PDRC1; 53 KDa Squamous Epithelial-Induced Stress Protein; Chromosome 1 Open Reading Frame 10; Squamous Epithelial Heat Shock Protein 53; DRC1; Cornulin; 58 KDa Hea
-
AA Sequence
MPQLLQNINGIIEAFRRYARTEGNCTALTRGELKRLLEQEFADVIVKPHDPATVDEVLRLLDEDHTGTVEFKEFLVLVFKVAQACFKTLSESAEGACGSQESGSLHSGASQELGEGQRSGTEVGRAGKGQHYEGSSHRQS
-
Predicted Molecular Mass
17.5 kDa
-
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)