Cornulin Protein, Human (His)

Cornulin protein is critical in cell dynamics, promoting proliferation and promoting G1/S cell cycle progression, inducing the key regulator CCND1. It actively participates in the NFKB1 and PI3K/AKT pathways and responds to pro-inflammatory cytokines. Cornulin Protein, Human (His) is the recombinant human-derived Cornulin protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

Cornulin protein is critical in cell dynamics, promoting proliferation and promoting G1/S cell cycle progression, inducing the key regulator CCND1. It actively participates in the NFKB1 and PI3K/AKT pathways and responds to pro-inflammatory cytokines. Cornulin Protein, Human (His) is the recombinant human-derived Cornulin protein, expressed by E. coli , with N-6*His labeled tag.

Background

Cornulin Protein takes on a pivotal role in cellular dynamics by promoting cell proliferation and facilitating G1/S cell cycle progression. Its influence extends to the induction of CCND1, a crucial cell cycle regulator. Furthermore, Cornulin orchestrates the regulation of proliferation in response to pro-inflammatory cytokines, actively engaging the NFKB1 and PI3K/AKT signaling pathways. Operating as a homodimer, Cornulin emerges as a multifaceted player in cellular processes, contributing to the intricate balance of cell cycle control and response to inflammatory cues. The orchestrated interplay of Cornulin in these pathways underscores its significance in regulating cellular proliferation and highlights its potential implications in physiological and pathological contexts. Further exploration is warranted to comprehensively understand the specific molecular mechanisms underlying Cornulin's intricate involvement in cell cycle regulation and its responsiveness to pro-inflammatory stimuli.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-6*His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • 6*His
    • Cornulin (M1-S140)
      Accession # Q9UBG3
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CRNN; 53 KDa Putative Calcium-Binding Protein; Prev. C1orf10; Tumor-Related Protein; SEP53; PDRC1; 53 KDa Squamous Epithelial-Induced Stress Protein; Chromosome 1 Open Reading Frame 10; Squamous Epithelial Heat Shock Protein 53; DRC1; Cornulin; 58 KDa Hea

  • AA Sequence

    MPQLLQNINGIIEAFRRYARTEGNCTALTRGELKRLLEQEFADVIVKPHDPATVDEVLRLLDEDHTGTVEFKEFLVLVFKVAQACFKTLSESAEGACGSQESGSLHSGASQELGEGQRSGTEVGRAGKGQHYEGSSHRQS

  • Predicted Molecular Mass

    17.5 kDa

  • Molecular Weight

    Approximately 17 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00