1. Recombinant Proteins
  2. Others
  3. CRIP2 Protein, Human (sf9, His-GST)

The CRIP2 protein, also known as cysteine-rich intestinal protein 2, is a protein involved in a variety of cellular processes. CRIP2 protein interacts with TGFB1I1. CRIP2 Protein, Human (sf9, His-GST) is the recombinant human-derived CRIP2 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The CRIP2 protein, also known as cysteine-rich intestinal protein 2, is a protein involved in a variety of cellular processes. CRIP2 protein interacts with TGFB1I1. CRIP2 Protein, Human (sf9, His-GST) is the recombinant human-derived CRIP2 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

Background

CRIP2 protein, also known as Cysteine-rich intestinal protein 2, is a protein that is involved in various cellular processes. CRIP2 protein interacts with TGFB1I1. TGFB1I1, also known as Transforming Growth Factor Beta 1 Induced Transcript 1, is a protein that is induced by transforming growth factor beta 1 (TGF-β1) and is involved in TGF-β signaling pathways. The interaction between CRIP2 and TGFB1I1 suggests a potential role for CRIP2 in modulating TGF-β signaling or being involved in TGF-β-mediated cellular processes. However, further research is required to fully understand the functional significance of this interaction and the precise role of CRIP2 protein in cellular mechanisms regulated by TGF-β1 and TGFB1I1.

Species

Human

Source

Sf9 insect cells

Tag

N-His;N-GST

Accession

P52943 (M1-P208)

Gene ID
Molecular Construction
N-term
His-GST
CRIP2 (M1-P208)
Accession # P52943
C-term
Protein Length

Full Length

Synonyms
Cysteine-rich protein 2; CRP-2; Protein ESP1
AA Sequence

MASKCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCSKTLTPGGHAEHDGKPFCHKPCYATLFGPKGVNIGGAGSYIYEKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCPRCSKKVYFAEKVTSLGKDWHRPCLRCERCGKTLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDRDPEGKVQP

Predicted Molecular Mass
50.3 kDa
Molecular Weight

Approximately 49 kDa,based on SDS-PAGE under reducing conditions.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

CRIP2 Protein, Human (sf9, His-GST) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

CRIP2 Protein, Human (sf9, His-GST)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CRIP2 Protein, Human (sf9, His-GST)
Cat. No.:
HY-P76291
Quantity:
MCE Japan Authorized Agent: