CRIP2 Protein, Human (sf9, His-GST)

The CRIP2 protein, also known as cysteine-rich intestinal protein 2, is a protein involved in a variety of cellular processes. CRIP2 protein interacts with TGFB1I1. CRIP2 Protein, Human (sf9, His-GST) is the recombinant human-derived CRIP2 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: Sf9 insect cells
  • Storage:
    Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The CRIP2 protein, also known as cysteine-rich intestinal protein 2, is a protein involved in a variety of cellular processes. CRIP2 protein interacts with TGFB1I1. CRIP2 Protein, Human (sf9, His-GST) is the recombinant human-derived CRIP2 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.

Background

CRIP2 protein, also known as Cysteine-rich intestinal protein 2, is a protein that is involved in various cellular processes. CRIP2 protein interacts with TGFB1I1. TGFB1I1, also known as Transforming Growth Factor Beta 1 Induced Transcript 1, is a protein that is induced by transforming growth factor beta 1 (TGF-β1) and is involved in TGF-β signaling pathways. The interaction between CRIP2 and TGFB1I1 suggests a potential role for CRIP2 in modulating TGF-β signaling or being involved in TGF-β-mediated cellular processes. However, further research is required to fully understand the functional significance of this interaction and the precise role of CRIP2 protein in cellular mechanisms regulated by TGF-β1 and TGFB1I1.

Technical Parameters

  • Species Human
  • Source Sf9 insect cells
  • Tag N-His;N-GST
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His-GST
    • CRIP2 (M1-P208)
      Accession # P52943
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    CRIP2; Cysteine-Rich Intestinal Protein; Cysteine Rich Protein 2; LIM Domain Protein ESP1/CRP2; CRP2; Protein ESP1; Cysteine-Rich Protein 2; CRP-2; ESP1; CRIP

  • AA Sequence

    MASKCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCSKTLTPGGHAEHDGKPFCHKPCYATLFGPKGVNIGGAGSYIYEKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCPRCSKKVYFAEKVTSLGKDWHRPCLRCERCGKTLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDRDPEGKVQP

  • Predicted Molecular Mass

    50.3 kDa

  • Molecular Weight

    Approximately 49 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Solution

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00