CRIP2 Protein, Human (sf9, His-GST)
The CRIP2 protein, also known as cysteine-rich intestinal protein 2, is a protein involved in a variety of cellular processes. CRIP2 protein interacts with TGFB1I1. CRIP2 Protein, Human (sf9, His-GST) is the recombinant human-derived CRIP2 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The CRIP2 protein, also known as cysteine-rich intestinal protein 2, is a protein involved in a variety of cellular processes. CRIP2 protein interacts with TGFB1I1. CRIP2 Protein, Human (sf9, His-GST) is the recombinant human-derived CRIP2 protein, expressed by Sf9 insect cells , with N-His, N-GST labeled tag.
Background
CRIP2 protein, also known as Cysteine-rich intestinal protein 2, is a protein that is involved in various cellular processes. CRIP2 protein interacts with TGFB1I1. TGFB1I1, also known as Transforming Growth Factor Beta 1 Induced Transcript 1, is a protein that is induced by transforming growth factor beta 1 (TGF-β1) and is involved in TGF-β signaling pathways. The interaction between CRIP2 and TGFB1I1 suggests a potential role for CRIP2 in modulating TGF-β signaling or being involved in TGF-β-mediated cellular processes. However, further research is required to fully understand the functional significance of this interaction and the precise role of CRIP2 protein in cellular mechanisms regulated by TGF-β1 and TGFB1I1.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-His;N-GST
-
Accession
P52943 (M1-P208)
-
Molecular Construction
-
N-term
-
His-GST
-
CRIP2 (M1-P208)
Accession # P52943 -
C-term
-
-
Protein Length
Full Length
-
Synonyms
CRIP2; Cysteine-Rich Intestinal Protein; Cysteine Rich Protein 2; LIM Domain Protein ESP1/CRP2; CRP2; Protein ESP1; Cysteine-Rich Protein 2; CRP-2; ESP1; CRIP
-
AA Sequence
MASKCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCSKTLTPGGHAEHDGKPFCHKPCYATLFGPKGVNIGGAGSYIYEKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCPRCSKKVYFAEKVTSLGKDWHRPCLRCERCGKTLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDRDPEGKVQP
-
Predicted Molecular Mass
50.3 kDa
-
Molecular Weight
Approximately 49 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
