CTHRC1 Protein, Rat (HEK293, His)
Based on 1 Customer Validation
CTHRC1, with predicted Wnt-protein and frizzled binding activity, influences cell migration. Located in the extracellular matrix, this protein, implicated in Barrett's esophagus, exhibits biased expression in lung (RPKM 46.1) and muscle (RPKM 36.6), suggesting its role in diverse physiological processes across tissues. CTHRC1 Protein, Rat (HEK293, His) is the recombinant rat-derived CTHRC1 protein, expressed by HEK293 , with C-His labeled tag.
- Species: Rat
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
CTHRC1, with predicted Wnt-protein and frizzled binding activity, influences cell migration. Located in the extracellular matrix, this protein, implicated in Barrett's esophagus, exhibits biased expression in lung (RPKM 46.1) and muscle (RPKM 36.6), suggesting its role in diverse physiological processes across tissues. CTHRC1 Protein, Rat (HEK293, His) is the recombinant rat-derived CTHRC1 protein, expressed by HEK293 , with C-His labeled tag.
Background
CTHRC1, a protein predicted to possess Wnt-protein binding activity and frizzled binding activity, operates upstream of or within the process of cell migration. This protein is located in the extracellular matrix, and its human ortholog(s) have been implicated in Barrett's esophagus. With biased expression observed in tissues such as lung (RPKM 46.1) and muscle (RPKM 36.6), CTHRC1 may play a significant role in diverse physiological processes across different tissues.
MCE Validation Data
-
Purity - SDS-PAGE
Purity - SDS-PAGE
Technical Parameters
-
Species Rat
-
Source HEK293
-
Tag C-6*His
-
Accession
NP_001258229 (S33-K230)
-
Molecular Construction
-
N-term
-
CTHRC1 (M1-K230)
Accession # NP_001258229 -
His
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CTHRC1; Collagen Triple Helix Repeat-Containing Protein 1; Collagen Triple Helix Repeat Containing 1
-
AA Sequence
SENPKYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPELNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK
-
Molecular Weight
Approximately 27 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
