1. Recombinant Proteins
  2. Others
  3. CTHRC1 Protein, Rat (HEK293, His)

CTHRC1, with predicted Wnt-protein and frizzled binding activity, influences cell migration. Located in the extracellular matrix, this protein, implicated in Barrett's esophagus, exhibits biased expression in lung (RPKM 46.1) and muscle (RPKM 36.6), suggesting its role in diverse physiological processes across tissues. CTHRC1 Protein, Rat (HEK293, His) is the recombinant rat-derived CTHRC1 protein, expressed by HEK293 , with C-His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
무료 샘플   Apply now
5 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

  • References

제품 설명

CTHRC1, with predicted Wnt-protein and frizzled binding activity, influences cell migration. Located in the extracellular matrix, this protein, implicated in Barrett's esophagus, exhibits biased expression in lung (RPKM 46.1) and muscle (RPKM 36.6), suggesting its role in diverse physiological processes across tissues. CTHRC1 Protein, Rat (HEK293, His) is the recombinant rat-derived CTHRC1 protein, expressed by HEK293 , with C-His labeled tag.

Background

CTHRC1, a protein predicted to possess Wnt-protein binding activity and frizzled binding activity, operates upstream of or within the process of cell migration. This protein is located in the extracellular matrix, and its human ortholog(s) have been implicated in Barrett's esophagus. With biased expression observed in tissues such as lung (RPKM 46.1) and muscle (RPKM 36.6), CTHRC1 may play a significant role in diverse physiological processes across different tissues.

Species

Rat

Source

HEK293

Tag

C-6*His

Accession

NP_001258229 (S33-K230)

Gene ID
Molecular Construction
N-term
CTHRC1 (M1-K230)
Accession # NP_001258229
His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Collagen triple helix repeat-containing protein 1; Protein NMTC1; CTHRC1
AA Sequence

SENPKYNGMCLQGPAGVPGRDGSPGANGIPGTPGIPGRDGFKGEKGECLRESFEESWTPNYKQCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPIEAIIYLDQGSPELNSTINIHRTSSVEGLCEGIGAGLVDVAIWVGTCSDYPKGDASTGWNSVSRIIIEELPK

분자량

Approximately 27 kDa

Glycosylation
Yes
Purity
  • ≥ 90%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류
References

CTHRC1 Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

CTHRC1 Protein, Rat (HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
CTHRC1 Protein, Rat (HEK293, His)
Cat. No.:
HY-P76299
수량:
MCE Japan Authorized Agent: