CXCL17 Protein, Human
Based on 1 Customer Validation
The CXCL17 protein is a chemokine that attracts monocytes, macrophages, and dendritic cells and plays a role in angiogenesis and potential tumor development. CXCL17 Protein, Human is the recombinant human-derived CXCL17 protein, expressed by E. coli , with tag free.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The CXCL17 protein is a chemokine that attracts monocytes, macrophages, and dendritic cells and plays a role in angiogenesis and potential tumor development. CXCL17 Protein, Human is the recombinant human-derived CXCL17 protein, expressed by E. coli , with tag free.
Background
CXCL17 protein functions as a chemokine with chemoattractant properties for monocytes, macrophages, and dendritic cells, as demonstrated in various studies. Its involvement extends to angiogenesis and potentially tumor development, emphasizing its role in complex physiological processes. In the stomach, CXCL17 acts as an anti-inflammatory agent, contributing to local immune regulation. Additionally, there is a suggestion that CXCL17 may participate in the innate defense against infections, broadening its significance in immune responses. Through its interaction with the C-X-C chemokine receptor GPR35, CXCL17 induces a rapid and transient increase in intracellular calcium ions, adding a layer of specificity to its signaling mechanisms. Notably, CXCL17 exhibits a considerably higher chemoattractant potency on monocytes and macrophages compared to 6-Cys CXCL17, underscoring its distinct functional characteristics.
Verified Bioactivity
Fully biologically active when compared to standard. The ED50 as determined by its ability to induce VEGF expression using murine endothelial cells is less than 5.0 μg/mL, corresponding to a specific activity of >200 IU/mg.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag Tag Free
-
Accession
Q6UXB2 (S22-L119)
-
Molecular Construction
-
N-term
-
CXCL17 (S22-119L)
Accession # Q6UXB2 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
CXCL17; Chemokine (C-X-C Motif) Ligand 17; C-X-C Motif Chemokine Ligand 17; VEGF Coregulated Chemokine 1; VCC1; C-X-C Motif Chemokine 17; DMC; 6-Cys CXCL17; UNQ473; VEGF Co-Regulated Chemokine 1; Dcip1; VCC-1; Dendritic Cell And Monocyte Chemokine-Like Pr
-
AA Sequence
SSLNPGVARGHRDRGQASRRWLQEGGQECECKDWFLRAPRRKFMTVSGLPKKQCPCDHFKGNVKKTRHQRHHRKPNKHSRACQQFLKQCQLRSFALPL
-
Predicted Molecular Mass
11.5 kDa
-
Molecular Weight
Approximately 12 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm concentrated solution in PBS with 3% trehalose, pH 7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)