IL-8/CXCL8 Protein, Rhesus macaque (HEK293, His)

CXCL8 protein, a crucial chemotactic factor, drives inflammatory responses by attracting neutrophils, basophils, and T-cells, contributing to pathogen clearance. It plays a pivotal role in activating neutrophils and binds to CXCR1/CXCR2 receptors, initiating downstream signaling pathways. CXCL8 homodimerizes and interacts with TNFAIP6, potentially regulating chemokine activity in the inflammatory microenvironment. IL-8/CXCL8 Protein, Rhesus macaque (HEK293, His) is the recombinant rhesus macaque-derived CXCL8 protein, expressed by HEK293, with C-His labeled tag.

CXCL8 protein functions as a critical chemotactic factor that orchestrates the inflammatory response by attracting neutrophils, basophils, and T-cells, thereby aiding in the clearance of pathogens and safeguarding the host from infections. Additionally, CXCL8 plays a pivotal role in activating neutrophils. Upon release in response to inflammatory stimuli, CXCL8 exerts its effects by binding to the G-protein-coupled receptors CXCR1 and CXCR2, predominantly present in neutrophils, monocytes, and endothelial cells. The G-protein heterotrimer (alpha, beta, gamma subunits) constitutively binds to the CXCR1/CXCR2 receptor, and activation by CXCL8 results in the release of beta and gamma subunits from Galpha (GNAI2 in neutrophils), subsequently activating various downstream signaling pathways, including PI3K and MAPK pathways. CXCL8 forms homodimers, and its interaction with TNFAIP6 via the Link domain interferes with chemokine binding to glycosaminoglycans, suggesting a regulatory role in modulating chemokine activity within the inflammatory microenvironment.

Rhesus Macaque

HEK293

C-His

P67813 (A23-P101)

613028

Full Length of Mature Protein

AVLPRSAKELRCECIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKEPWVQRVVEKFVKRAENQNP

Approximately 13-14 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from 0.22 μm filtered solution of PBS, pH7.4 with trehalose as protectant.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.