CXCR4 Protein, Human (GST)

The CXCR4 protein functions as a receptor for the CXC chemokine CXCL12/SDF-1, triggering an increase in intracellular calcium ions and activation of MAPK1/MAPK3. It is actively involved in AKT signaling, which is critical for regulating cell migration, especially in wound healing. CXCR4 Protein, Human (GST) is the recombinant human-derived CXCR4 protein, expressed by E. coli , with N-GST labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The CXCR4 protein functions as a receptor for the CXC chemokine CXCL12/SDF-1, triggering an increase in intracellular calcium ions and activation of MAPK1/MAPK3. It is actively involved in AKT signaling, which is critical for regulating cell migration, especially in wound healing. CXCR4 Protein, Human (GST) is the recombinant human-derived CXCR4 protein, expressed by E. coli , with N-GST labeled tag.

Background

The CXCR4 Protein serves as a receptor for the C-X-C chemokine CXCL12/SDF-1, transmitting signals that increase intracellular calcium ion levels and enhance MAPK1/MAPK3 activation. It is actively involved in the AKT signaling cascade and plays a crucial role in regulating cell migration, particularly during processes like wound healing. Additionally, CXCR4 acts as a receptor for extracellular ubiquitin, leading to elevated intracellular calcium ions and reduced cellular cAMP levels. It also binds bacterial lipopolysaccharide (LPS) and mediates LPS-induced inflammatory responses, including TNF secretion by monocytes. Beyond its immunological functions, CXCR4 plays essential roles in hematopoiesis, cardiac ventricular septum formation, vascularization of the gastrointestinal tract, and cerebellar development. In the central nervous system, it may mediate hippocampal-neuron survival. Furthermore, in the context of microbial infection, CXCR4 acts as a coreceptor, alongside CD4, for human immunodeficiency virus-1 (HIV-1) X4 isolates and serves as a primary receptor for certain HIV-2 isolates, promoting viral fusion.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-GST
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • GST
    • CXCR4 (P303-S352)
      Accession # P61073-2
    • C-term
  • Protein Length

    Cytoplasmic Domain

  • Synonyms

    CXCR4; SDF-1 Receptor; C-X-C Motif Chemokine Receptor 4; CD184 Antigen; LESTR; LAP-3; Fusin; NPYRL; HM89; FB22; C-X-C Chemokine Receptor Type 4; LCR1; D2S201E; Seven-Transmembrane-Segment Receptor, Spleen; NPYY3R; Chemokine (C-X-C Motif), Receptor 4 (Fusi

  • AA Sequence

    PILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSS

  • Predicted Molecular Mass

    32.6 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00