1. Recombinant Proteins
  2. Cytokines and Growth Factors Receptor Proteins
  3. Chemokine & Receptors G-Protein-Coupled Receptors
  4. CXC chemokine subfamily Rhodopsin-like receptors
  5. CXCR4 Protein, Human (GST)

CXCR4 Protein, Human (GST)

Cat. No.: HY-P72160
Handling Instructions

For research use only. We do not sell to patients.

Protein Expression Service

Recombinant Proteins-MedChemExpress
Size Stock
20 μg Ask For Quote & Lead Time
100 μg Ask For Quote & Lead Time

* Please select Quantity before adding items.

CXCR4 Protein, Human (GST) Featured Recommendations:

Top Publications Citing Use of Products
  • Technical Parameters

  • Properties

  • Documentation

Species

Human

Source

E. coli

Tag

N-GST

Accession

P61073 (P303-S352)

Gene ID

7852

Synonyms
C-X-C chemokine receptor type 4; CD184; CD184 antigen; Chemokine C X C motif; receptor 4; Chemokine CXC Motif Receptor 4; CXC-R4; CXCR-4; CXCR4; CXCR4_HUMAN; D2S201E; FB22; Fusin; HM89; HSY3RR; LAP 3; LAP3; LCR1; LESTR; Leukocyte derived seven transmembrane domain receptor; Leukocyte-derived seven transmembrane domain receptor; Lipopolysaccharide associated protein 3; Neuropeptide Y receptor Y3; NPY3R; NPYR; NPYRL; NPYY3; NPYY3R; Probable G protein coupled receptor lcr1 homolog; SDF 1 receptor; SDF-1 receptor; SEVEN-TRANSMEMBRANE-SEGMENT RECEPTOR; Stromal cell derived factor 1 receptor; Stromal cell-derived factor 1 receptor; WHIM; WHIMS
AA Sequence

PILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSS

Molecular Weight

Approximately 32.6 kDa

Purity

Greater than 90% as determined by SDS-PAGE.

Biological Activity
Data is not available.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm solution of Tris-based buffer, 50% Glycerol.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in sterile distilled water.

Storage & Stability

Stored at -20°C. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer. It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation
  • Reconstitution Calculator

  • Dilution Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email address *

Phone number *

 

Organization name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
CXCR4 Protein, Human (GST)
Cat. No.:
HY-P72160
Quantity:
MCE Japan Authorized Agent: