CXCR4 Protein, Human (N-His-SUMO, C-Myc)
Based on 1 Customer Validation
The CXCR4 protein functions as a receptor for the CXC chemokine CXCL12/SDF-1, triggering an increase in intracellular calcium ions and activation of MAPK1/MAPK3. It is actively involved in AKT signaling, which is critical for regulating cell migration, especially in wound healing. CXCR4 Protein, Human (N-His-SUMO, C-Myc) is the recombinant human-derived CXCR4 protein, expressed by E. coli , with N-10*His, C-Myc, N-SUMO labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The CXCR4 protein functions as a receptor for the CXC chemokine CXCL12/SDF-1, triggering an increase in intracellular calcium ions and activation of MAPK1/MAPK3. It is actively involved in AKT signaling, which is critical for regulating cell migration, especially in wound healing. CXCR4 Protein, Human (N-His-SUMO, C-Myc) is the recombinant human-derived CXCR4 protein, expressed by E. coli , with N-10*His, C-Myc, N-SUMO labeled tag.
Background
The CXCR4 Protein serves as a receptor for the C-X-C chemokine CXCL12/SDF-1, transmitting signals that increase intracellular calcium ion levels and enhance MAPK1/MAPK3 activation. It is actively involved in the AKT signaling cascade and plays a crucial role in regulating cell migration, particularly during processes like wound healing. Additionally, CXCR4 acts as a receptor for extracellular ubiquitin, leading to elevated intracellular calcium ions and reduced cellular cAMP levels. It also binds bacterial lipopolysaccharide (LPS) and mediates LPS-induced inflammatory responses, including TNF secretion by monocytes. Beyond its immunological functions, CXCR4 plays essential roles in hematopoiesis, cardiac ventricular septum formation, vascularization of the gastrointestinal tract, and cerebellar development. In the central nervous system, it may mediate hippocampal-neuron survival. Furthermore, in the context of microbial infection, CXCR4 acts as a coreceptor, alongside CD4, for human immunodeficiency virus-1 (HIV-1) X4 isolates and serves as a primary receptor for certain HIV-2 isolates, promoting viral fusion.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-10*His;C-Myc;N-SUMO
-
Accession
P61073-2 (P303-S352)
-
Molecular Construction
-
N-term
-
10*His
-
CXCR4 (P303-S352)
Accession # P61073-2 -
Myc
-
C-term
-
-
Protein Length
Cytoplasmic Domain
-
Synonyms
CXCR4; SDF-1 Receptor; C-X-C Motif Chemokine Receptor 4; CD184 Antigen; LESTR; LAP-3; Fusin; NPYRL; HM89; FB22; C-X-C Chemokine Receptor Type 4; LCR1; D2S201E; Seven-Transmembrane-Segment Receptor, Spleen; NPYY3R; Chemokine (C-X-C Motif), Receptor 4 (Fusi
-
AA Sequence
PILYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSS
-
Predicted Molecular Mass
25.2 kDa
-
Molecular Weight
Approximately 28 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HC1, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)