DBI Protein, Mouse (His-Myc)
Based on 1 Customer Validation
DBI Protein, with high affinity, binds medium- and long-chain acyl-CoA esters, potentially acting as an intracellular carrier. Moreover, DBI displaces diazepam from the benzodiazepine (BZD) recognition site on the GABA type A receptor, suggesting a neuropeptide role in modulating GABA receptor action. Structurally, as a monomer, DBI underscores the importance of its individual unit in diverse molecular interactions within cellular pathways. DBI Protein, Mouse (His-Myc) is the recombinant mouse-derived DBI protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.
- Species: Mouse
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
DBI Protein, with high affinity, binds medium- and long-chain acyl-CoA esters, potentially acting as an intracellular carrier. Moreover, DBI displaces diazepam from the benzodiazepine (BZD) recognition site on the GABA type A receptor, suggesting a neuropeptide role in modulating GABA receptor action. Structurally, as a monomer, DBI underscores the importance of its individual unit in diverse molecular interactions within cellular pathways. DBI Protein, Mouse (His-Myc) is the recombinant mouse-derived DBI protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.
Background
The DBI Protein plays a crucial role in intracellular processes by binding with high affinity to medium- and long-chain acyl-CoA esters, suggesting its potential function as an intracellular carrier for these molecules. Additionally, DBI exhibits the ability to displace diazepam from the benzodiazepine (BZD) recognition site on the GABA type A receptor. This dual functionality raises the possibility that DBI may act as a neuropeptide, modulating the action of the GABA receptor. Structurally, the protein exists as a monomer, emphasizing its individual unit's significance in executing these diverse molecular interactions within cellular pathways.
Verified Bioactivity
The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.
Technical Parameters
-
Species Mouse
-
Source E. coli
-
Tag N-10*His;C-Myc
-
Accession
P31786 (S2-I87)
-
Molecular Construction
-
N-term
-
10*His
-
DBI (S2-I87)
Accession # P31786 -
Myc
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
DBI; EP; Diazepam Binding Inhibitor, Acyl-CoA Binding Protein; Diazepam Binding Inhibitor (GABA Receptor Modulator, Acyl-CoA Binding Protein); ACBP; Cholecystokinin-Releasing Peptide, Trypsin-Sensitive; Acyl-CoA-Binding Protein; Acyl-Coenzyme A Binding Do
-
AA Sequence
SQAEFDKAAEEVKRLKTQPTDEEMLFIYSHFKQATVGDVNTDRPGLLDLKGKAKWDSWNKLKGTSKESAMKTYVEKVDELKKKYGI
-
Predicted Molecular Mass
16.9 kDa
-
Molecular Weight
Approximately 19 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
