1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. DBI Protein, Mouse (His-Myc)

DBI Protein, with high affinity, binds medium- and long-chain acyl-CoA esters, potentially acting as an intracellular carrier. Moreover, DBI displaces diazepam from the benzodiazepine (BZD) recognition site on the GABA type A receptor, suggesting a neuropeptide role in modulating GABA receptor action. Structurally, as a monomer, DBI underscores the importance of its individual unit in diverse molecular interactions within cellular pathways. DBI Protein, Mouse (His-Myc) is the recombinant mouse-derived DBI protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

DBI Protein, with high affinity, binds medium- and long-chain acyl-CoA esters, potentially acting as an intracellular carrier. Moreover, DBI displaces diazepam from the benzodiazepine (BZD) recognition site on the GABA type A receptor, suggesting a neuropeptide role in modulating GABA receptor action. Structurally, as a monomer, DBI underscores the importance of its individual unit in diverse molecular interactions within cellular pathways. DBI Protein, Mouse (His-Myc) is the recombinant mouse-derived DBI protein, expressed by E. coli , with N-10*His, C-Myc labeled tag.

Background

The DBI Protein plays a crucial role in intracellular processes by binding with high affinity to medium- and long-chain acyl-CoA esters, suggesting its potential function as an intracellular carrier for these molecules. Additionally, DBI exhibits the ability to displace diazepam from the benzodiazepine (BZD) recognition site on the GABA type A receptor. This dual functionality raises the possibility that DBI may act as a neuropeptide, modulating the action of the GABA receptor. Structurally, the protein exists as a monomer, emphasizing its individual unit's significance in executing these diverse molecular interactions within cellular pathways.

Biological Activity

The enzyme activity of this recombinant protein is testing in progress, we cannot offer a guarantee yet.

Species

Mouse

Source

E. coli

Tag

N-10*His;C-Myc

Accession

P31786 (S2-I87)

Gene ID
Molecular Construction
N-term
10*His
DBI (S2-I87)
Accession # P31786
Myc
C-term
Protein Length

Full Length of Mature Protein

Synonyms
DbiAcyl-CoA-binding protein; ACBP; Diazepam-binding inhibitor; DBI; Endozepine; EP
AA Sequence

SQAEFDKAAEEVKRLKTQPTDEEMLFIYSHFKQATVGDVNTDRPGLLDLKGKAKWDSWNKLKGTSKESAMKTYVEKVDELKKKYGI

Molecular Weight

Approximately 19 kDa

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCl, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

DBI Protein, Mouse (His-Myc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

DBI Protein, Mouse (His-Myc)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
DBI Protein, Mouse (His-Myc)
Cat. No.:
HY-P72167
Quantity:
MCE Japan Authorized Agent: