1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. DBT Protein, Human (sf9, His)

DBT proteins are components of the branched-chain α-keto dehydrogenase complex, which catalyzes the conversion of α-keto acids into acyl-CoA and CO(2). This complex includes branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2), and lipoamide dehydrogenase (E3). DBT Protein, Human (sf9, His) is the recombinant human-derived DBT protein, expressed by Sf9 insect cells , with N-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

DBT proteins are components of the branched-chain α-keto dehydrogenase complex, which catalyzes the conversion of α-keto acids into acyl-CoA and CO(2). This complex includes branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2), and lipoamide dehydrogenase (E3). DBT Protein, Human (sf9, His) is the recombinant human-derived DBT protein, expressed by Sf9 insect cells , with N-His labeled tag.

Background

The DBT protein, an integral part of the branched-chain alpha-keto dehydrogenase complex, plays a pivotal role in catalyzing the comprehensive conversion of alpha-keto acids to acyl-CoA and CO(2). This complex comprises multiple copies of three distinct enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2), and lipoamide dehydrogenase (E3). Specifically, within this intricate assembly, the catalytic function of the DBT enzyme involves the acceptance and subsequent transfer to coenzyme A of acyl groups generated by the branched-chain alpha-keto acid decarboxylase component. This enzymatic cascade underscores the essential contribution of DBT in mediating a key step in the metabolic pathway, facilitating the conversion of alpha-keto acids to biologically relevant acyl-CoA molecules.

Species

Human

Source

Sf9 insect cells

Tag

N-His

Accession

P11182 (G62-K482)

Gene ID
Molecular Construction
N-term
His
DBT (G62-K482)
Accession # P11182
C-term
Protein Length

Full Length of Mature Protein

Synonyms
Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex; BCKAD-E2; DBT
AA Sequence

GQVVQFKLSDIGEGIREVTVKEWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKKLYYNLDDIAYVGKPLVDIETEALKDSEEDVVETPAVSHDEHTHQEIKGRKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNYLEKQTGAILPPSPKVEIMPPPPKPKDMTVPILVSKPPVFTGKDKTEPIKGFQKAMVKTMSAALKIPHFGYCDEIDLTELVKLREELKPIAFARGIKLSFMPFFLKAASLGLLQFPILNASVDENCQNITYKASHNIGIAMDTEQGLIVPNVKNVQICSIFDIATELNRLQKLGSVSQLSTTDLTGGTFTLSNIGSIGGTFAKPVIMPPEVAIGALGSIKAIPRFNQKGEVYKAQIMNVSWSADHRVIDGATMSRFSNLWKSYLENPAFMLLDLK

Predicted Molecular Mass
48.8 kDa
Purity

≥ 95%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

DBT Protein, Human (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

DBT Protein, Human (sf9, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
DBT Protein, Human (sf9, His)
Cat. No.:
HY-P74207
Quantity:
MCE Japan Authorized Agent: