DBT Protein, Human (sf9, His)
DBT proteins are components of the branched-chain α-keto dehydrogenase complex, which catalyzes the conversion of α-keto acids into acyl-CoA and CO(2). This complex includes branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2), and lipoamide dehydrogenase (E3). DBT Protein, Human (sf9, His) is the recombinant human-derived DBT protein, expressed by Sf9 insect cells , with N-His labeled tag.
- Species: Human
- Source: Sf9 insect cells
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
DBT proteins are components of the branched-chain α-keto dehydrogenase complex, which catalyzes the conversion of α-keto acids into acyl-CoA and CO(2). This complex includes branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2), and lipoamide dehydrogenase (E3). DBT Protein, Human (sf9, His) is the recombinant human-derived DBT protein, expressed by Sf9 insect cells , with N-His labeled tag.
Background
The DBT protein, an integral part of the branched-chain alpha-keto dehydrogenase complex, plays a pivotal role in catalyzing the comprehensive conversion of alpha-keto acids to acyl-CoA and CO(2). This complex comprises multiple copies of three distinct enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2), and lipoamide dehydrogenase (E3). Specifically, within this intricate assembly, the catalytic function of the DBT enzyme involves the acceptance and subsequent transfer to coenzyme A of acyl groups generated by the branched-chain alpha-keto acid decarboxylase component. This enzymatic cascade underscores the essential contribution of DBT in mediating a key step in the metabolic pathway, facilitating the conversion of alpha-keto acids to biologically relevant acyl-CoA molecules.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag N-His
-
Accession
P11182 (G62-K482)
-
Molecular Construction
-
N-term
-
His
-
DBT (G62-K482)
Accession # P11182 -
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
DBT; Dihydrolipoamide Branched Chain Transacylase (E2 Component Of Branched Chain Keto Acid Dehydrogenase Complex; Maple Syrup Urine Disease); Dihydrolipoamide Branched Chain Transacylase E2; Lipoamide Acyltransferase Component Of Mitochondrial Branched-C
-
AA Sequence
GQVVQFKLSDIGEGIREVTVKEWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKKLYYNLDDIAYVGKPLVDIETEALKDSEEDVVETPAVSHDEHTHQEIKGRKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNYLEKQTGAILPPSPKVEIMPPPPKPKDMTVPILVSKPPVFTGKDKTEPIKGFQKAMVKTMSAALKIPHFGYCDEIDLTELVKLREELKPIAFARGIKLSFMPFFLKAASLGLLQFPILNASVDENCQNITYKASHNIGIAMDTEQGLIVPNVKNVQICSIFDIATELNRLQKLGSVSQLSTTDLTGGTFTLSNIGSIGGTFAKPVIMPPEVAIGALGSIKAIPRFNQKGEVYKAQIMNVSWSADHRVIDGATMSRFSNLWKSYLENPAFMLLDLK
-
Predicted Molecular Mass
48.8 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)