1. Recombinant Proteins
  2. Ubiquitin Related Proteins
  3. DCAF7 Protein, Human (sf9)

The DCAF7 protein occupies a central position in craniofacial development and is critical for the EDN1 pathway and maxillary formation. Its nuanced involvement suggests different requirements for EDN1 function in the first and second arches. DCAF7 Protein, Human (sf9) is the recombinant human-derived DCAF7 protein, expressed by sf9 insect cells , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The DCAF7 protein occupies a central position in craniofacial development and is critical for the EDN1 pathway and maxillary formation. Its nuanced involvement suggests different requirements for EDN1 function in the first and second arches. DCAF7 Protein, Human (sf9) is the recombinant human-derived DCAF7 protein, expressed by sf9 insect cells , with tag free.

Background

DCAF7 protein takes center stage in craniofacial development, playing a pivotal role upstream of the EDN1 pathway and contributing significantly to the formation of the upper jaw equivalent, the palatoquadrate. Its nuanced involvement is highlighted by distinct activity requirements for EDN1 pathway function in the first and second arches. Additionally, DCAF7 forms an intricate partnership with DIAPH1, exerting control over GLI1 transcriptional activity. Beyond craniofacial development, this protein emerges as a potential player in both normal and disease-related skin development. Notably, it may function as a substrate receptor for the CUL4-DDB1 E3 ubiquitin-protein ligase complex, shedding light on its engagement in protein modification processes, particularly protein ubiquitination.

Species

Human

Source

Sf9 insect cells

Tag

Tag Free

Accession

P61962 (S2-V342)

Gene ID

10238

Molecular Construction
N-term
DCAF7 (S2-V342)
Accession # P61962
C-term
Protein Length

Partial

Synonyms
DCAF7; DDB1- and CUL4-associated factor 7; WD repeat-containing protein 68; WD repeat-containing protein An11 homolog
AA Sequence

SLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVGLDEESSEFICRNTFDHPYPTTKLMWIPDTKGVYPDLLATSGDYLRVWRVGETETRLECLLNNNKNSDFCAPLTSFDWNEVDPYLLGTSSIDTTCTIWGLETGQVLGRVNLVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPQHHPLLRLCWNKQDPNYLATMAMDGMEVVILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWDIQQMPRAIEDPILAYTAEGEINNVQWASTQPDWIAICYNNCLEILRV

Purity

≥ 90%, as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

DCAF7 Protein, Human (sf9) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

DCAF7 Protein, Human (sf9)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
DCAF7 Protein, Human (sf9)
Cat. No.:
HY-P701521
Quantity:
MCE Japan Authorized Agent: