DCAF7 Protein, Human (sf9)
The DCAF7 protein occupies a central position in craniofacial development and is critical for the EDN1 pathway and maxillary formation. Its nuanced involvement suggests different requirements for EDN1 function in the first and second arches. DCAF7 Protein, Human (sf9) is the recombinant human-derived DCAF7 protein, expressed by sf9 insect cells , with tag free.
- Species: Human
- Source: Sf9 insect cells
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
The DCAF7 protein occupies a central position in craniofacial development and is critical for the EDN1 pathway and maxillary formation. Its nuanced involvement suggests different requirements for EDN1 function in the first and second arches. DCAF7 Protein, Human (sf9) is the recombinant human-derived DCAF7 protein, expressed by sf9 insect cells , with tag free.
DCAF7 protein takes center stage in craniofacial development, playing a pivotal role upstream of the EDN1 pathway and contributing significantly to the formation of the upper jaw equivalent, the palatoquadrate. Its nuanced involvement is highlighted by distinct activity requirements for EDN1 pathway function in the first and second arches. Additionally, DCAF7 forms an intricate partnership with DIAPH1, exerting control over GLI1 transcriptional activity. Beyond craniofacial development, this protein emerges as a potential player in both normal and disease-related skin development. Notably, it may function as a substrate receptor for the CUL4-DDB1 E3 ubiquitin-protein ligase complex, shedding light on its engagement in protein modification processes, particularly protein ubiquitination.
Technical Parameters
-
Species Human
-
Source Sf9 insect cells
-
Tag Tag Free
-
Accession
P61962 (S2-V342)
-
Gene ID10238
-
Molecular Construction
-
N-term
-
DCAF7 (S2-V342)
Accession # P61962 -
C-term
-
-
Protein Length
Partial
-
Synonyms
DCAF7; WD Repeat-Containing Protein 68; Prev. WDR68; Seven-WD-Repeat Protein Of The AN11 Family-1; HAN11; Human Anthocyanin; WD Repeat-Containing Protein An11 Homolog; WD Repeat Domain 68; DDB1- And CUL4-Associated Factor 7; AN11; DDB1 And CUL4 Associated
-
AA Sequence
SLHGKRKEIYKYEAPWTVYAMNWSVRPDKRFRLALGSFVEEYNNKVQLVGLDEESSEFICRNTFDHPYPTTKLMWIPDTKGVYPDLLATSGDYLRVWRVGETETRLECLLNNNKNSDFCAPLTSFDWNEVDPYLLGTSSIDTTCTIWGLETGQVLGRVNLVSGHVKTQLIAHDKEVYDIAFSRAGGGRDMFASVGADGSVRMFDLRHLEHSTIIYEDPQHHPLLRLCWNKQDPNYLATMAMDGMEVVILDVRVPCTPVARLNNHRACVNGIAWAPHSSCHICTAADDHQALIWDIQQMPRAIEDPILAYTAEGEINNVQWASTQPDWIAICYNNCLEILRV
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
