DEFA1 Protein, Human (HEK293, Twin Strep)

The DEFA1 protein is a multifunctional effector in innate immunity that exhibits antibiotic-like properties against bacteria, fungi, and viruses. It promotes immune defense by activating antigen-presenting cells (APCs) and inhibiting bacterial cell wall synthesis by interacting with lipid II. DEFA1 Protein, Human (HEK293, Twin Strep) is the recombinant human-derived DEFA1 protein, expressed by HEK293, with C-Twin-Strep labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The DEFA1 protein is a multifunctional effector in innate immunity that exhibits antibiotic-like properties against bacteria, fungi, and viruses. It promotes immune defense by activating antigen-presenting cells (APCs) and inhibiting bacterial cell wall synthesis by interacting with lipid II. DEFA1 Protein, Human (HEK293, Twin Strep) is the recombinant human-derived DEFA1 protein, expressed by HEK293, with C-Twin-Strep labeled tag.

Background

The DEFA1 Protein serves as a versatile effector within the innate immune system, wielding antibiotic-like properties against a diverse range of infectious agents, encompassing bacteria, fungi, and viruses. Additionally, DEFA1 contributes to immune defense by promoting the activation and maturation of antigen-presenting cells (APCs). Through interaction with the vital precursor of cell wall synthesis, lipid II, DEFA1 inhibits bacterial cell wall synthesis. It further impedes adenovirus infection by restraining viral disassembly at the vertex region, hindering the release of the internal capsid protein pVI crucial for endosomal membrane penetration during cell entry. The protein's interaction with adenovirus capsid redirects viral particles to TLR4, promoting a NLRP3-mediated inflammasome response and interleukin-1 beta (IL-1beta) release. DEFA1 induces the production of proinflammatory cytokines, including type I interferon, in plasmacytoid dendritic cells (pDCs) by triggering NFKBIA degradation and nuclear translocation of IRF1, both pivotal for pDC activation. Structurally, DEFA1 exists as both a tetramer and a dimer, illustrating its dynamic organization, and it interacts with RETN.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-Twin-Strep
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • DEFA1 (D39-C94)
      Accession # P59665
    • Twin-Strep
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    DEFA1; Neutrophil Defensin 1; Prev. DEFA2; Defensin, Alpha 1; Prev. DEF1; HP-1; Prev. MRS; HP1; HNP-1; Myeloid-Related Sequence; Defensin, Alpha 1, Myeloid-Related Sequence; Defensin Alpha 1; Defensin, Alpha 2

  • AA Sequence

    DIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC

  • Predicted Molecular Mass

    9.8 kDa

  • Molecular Weight

    Approximately 11-14 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00