DEFA1 Protein, Human (HEK293, Twin Strep)
The DEFA1 protein is a multifunctional effector in innate immunity that exhibits antibiotic-like properties against bacteria, fungi, and viruses. It promotes immune defense by activating antigen-presenting cells (APCs) and inhibiting bacterial cell wall synthesis by interacting with lipid II. DEFA1 Protein, Human (HEK293, Twin Strep) is the recombinant human-derived DEFA1 protein, expressed by HEK293, with C-Twin-Strep labeled tag.
- Species: Human
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Biological Activity
Description
The DEFA1 protein is a multifunctional effector in innate immunity that exhibits antibiotic-like properties against bacteria, fungi, and viruses. It promotes immune defense by activating antigen-presenting cells (APCs) and inhibiting bacterial cell wall synthesis by interacting with lipid II. DEFA1 Protein, Human (HEK293, Twin Strep) is the recombinant human-derived DEFA1 protein, expressed by HEK293, with C-Twin-Strep labeled tag.
Background
The DEFA1 Protein serves as a versatile effector within the innate immune system, wielding antibiotic-like properties against a diverse range of infectious agents, encompassing bacteria, fungi, and viruses. Additionally, DEFA1 contributes to immune defense by promoting the activation and maturation of antigen-presenting cells (APCs). Through interaction with the vital precursor of cell wall synthesis, lipid II, DEFA1 inhibits bacterial cell wall synthesis. It further impedes adenovirus infection by restraining viral disassembly at the vertex region, hindering the release of the internal capsid protein pVI crucial for endosomal membrane penetration during cell entry. The protein's interaction with adenovirus capsid redirects viral particles to TLR4, promoting a NLRP3-mediated inflammasome response and interleukin-1 beta (IL-1beta) release. DEFA1 induces the production of proinflammatory cytokines, including type I interferon, in plasmacytoid dendritic cells (pDCs) by triggering NFKBIA degradation and nuclear translocation of IRF1, both pivotal for pDC activation. Structurally, DEFA1 exists as both a tetramer and a dimer, illustrating its dynamic organization, and it interacts with RETN.
Technical Parameters
-
Species Human
-
Source HEK293
-
Tag C-Twin-Strep
-
Accession
P59665 (D39-C94)
-
Gene ID1667
-
Molecular Construction
-
N-term
-
DEFA1 (D39-C94)
Accession # P59665 -
Twin-Strep
-
C-term
-
-
Protein Length
Full Length of Mature Protein
-
Synonyms
DEFA1; Neutrophil Defensin 1; Prev. DEFA2; Defensin, Alpha 1; Prev. DEF1; HP-1; Prev. MRS; HP1; HNP-1; Myeloid-Related Sequence; Defensin, Alpha 1, Myeloid-Related Sequence; Defensin Alpha 1; Defensin, Alpha 2
-
AA Sequence
DIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC
-
Predicted Molecular Mass
9.8 kDa
-
Molecular Weight
Approximately 11-14 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
-
Glycosylation
Yes
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)