Copy Link Print Information

DKK-1 Protein, Rat (HEK293, His)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

DKK-1 Protein, with co-receptor and lipoprotein receptor binding activities, crucially regulates ossification and neuron death positively. Primarily located in the extracellular space, DKK-1 is implicated in anodontia, showing biased expression in kidney (RPKM 4.7), brain (RPKM 0.6), and two other tissues. Its role in the WNT signaling pathway and impact on visual epilepsy highlight its significance in developmental and neurological contexts. DKK-1 Protein, Rat (HEK293, His) is the recombinant rat-derived DKK-1 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for DKK-1 Protein, Rat (HEK293, His)
  • Experimental Validation Results for DKK-1 Protein, Rat (HEK293, His)
  • DKK-1 Protein, Rat (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

DKK-1 Protein, with co-receptor and lipoprotein receptor binding activities, crucially regulates ossification and neuron death positively. Primarily located in the extracellular space, DKK-1 is implicated in anodontia, showing biased expression in kidney (RPKM 4.7), brain (RPKM 0.6), and two other tissues. Its role in the WNT signaling pathway and impact on visual epilepsy highlight its significance in developmental and neurological contexts. DKK-1 Protein, Rat (HEK293, His) is the recombinant rat-derived DKK-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

DKK-1 Protein is predicted to play a crucial role in co-receptor binding, low-density lipoprotein particle receptor binding, and receptor antagonist activity. It is involved in the negative regulation of ossification and the positive regulation of neuron death, and its primary localization is in the extracellular space. This protein is implicated in anodontia, and its biased expression pattern is evident, with notable levels observed in the kidney (RPKM 4.7), brain (RPKM 0.6), and two other tissues. DKK-1's involvement in the WNT signaling pathway and its impact on visual epilepsy make it a significant factor in both developmental and neurological contexts.

Verified Bioactivity

Measured by its ability to inhibit Wnt3a-induced alkaline phosphatase production by C3H10T1/2 cells. The ED50 for this effect is approximately 0.1097 μg/ml in the presence of 10 ng/mL of mouse Wnt3a, corresponding to a specific activity is 9115.7703 units/mg.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - Cell-Based Assay

    Bioactivity - Cell-Based Assay

    Measured by its ability to inhibit Wnt3a-induced alkaline phosphatase production by C3H10T1/2 cells. The ED50 for this effect is approximately 0.1097 μg/mL in the presence of 10 ng/mL of mouse Wnt3a, corresponding to a specific activity is 9115.7703 units/mg.

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag C-6*His
  • Accession

    A6I0Z0/NP_001099820.1 (T32-H270)

  • Gene ID
    293897  [NCBI]
  • Molecular Construction
    • N-term
    • DKK-1 (T32-H270)
      Accession # A6I0Z0/NP_001099820.1
    • 6*His
    • C-term
  • Protein Length

    Full Length of Mature Protein

  • Synonyms

    DKK1; Dickkopf 1 Homolog (Xenopus Laevis); Dickkopf Wnt Signaling Pathway Inhibitor 1; Dickkopf 1 Homolog; SK; Dickkopf-1 Like; DKK-1; Dickkopf-1; Dickkopf-Related Protein 1; HDkk-1; Dickkopf-Like Protein 1; Dkk-1; Dickkopf (Xenopus Laevis) Homolog 1

  • AA Sequence

    TLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTLDNYQPYPCAEDEECGTDEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCPGNYCKNGICMPSDHSHLPRGEIEEGIIENLGNDHGAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCATGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLACRIQKDHHQTSNSSRLHTCQRH

  • Molecular Weight

    Approximately 38.58 kDa

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its ability to inhibit Wnt3a-induced alkaline phosphatase production by C3H10T1/2 cells. The ED50 for this effect is approximately 0.1097 μg/mL in the presence of 10 ng/mL of mouse Wnt3a, corresponding to a specific activity is 9115.7703 units/mg.

  • DKK-1 Protein, Rat (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for DKK-1 Protein, Rat (HEK293, His)
  • Experimental Validation Results for DKK-1 Protein, Rat (HEK293, His)
  • DKK-1 Protein, Rat (HEK293, His) Product Image