1. Recombinant Proteins
  2. Others
  3. DKK-1 Protein, Rat (HEK293, His)

DKK-1 Protein, with co-receptor and lipoprotein receptor binding activities, crucially regulates ossification and neuron death positively. Primarily located in the extracellular space, DKK-1 is implicated in anodontia, showing biased expression in kidney (RPKM 4.7), brain (RPKM 0.6), and two other tissues. Its role in the WNT signaling pathway and impact on visual epilepsy highlight its significance in developmental and neurological contexts. DKK-1 Protein, Rat (HEK293, His) is the recombinant rat-derived DKK-1 protein, expressed by HEK293 , with C-6*His labeled tag.

연구목적의 판매만을 진행합니다. 환자를 대상으로 한 판매는 하지 않습니다.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

사이즈 가격 재고 수량
무료 샘플   Apply now
무료 샘플   Apply now
5 μg 해외재고보유
10 μg 해외재고보유
50 μg 해외재고보유
100 μg 해외재고보유
> 100 μg   견적 받기  

* 장바구니에 담기 전 물품의 수량을 선택해 주십시오.

Top Publications Citing Use of Products

1 Publications Citing Use of MCE DKK-1 Protein, Rat (HEK293, His)

  • Biological Activity

  • Technical Parameters

  • Properties

  • 제품 설명

제품 설명

DKK-1 Protein, with co-receptor and lipoprotein receptor binding activities, crucially regulates ossification and neuron death positively. Primarily located in the extracellular space, DKK-1 is implicated in anodontia, showing biased expression in kidney (RPKM 4.7), brain (RPKM 0.6), and two other tissues. Its role in the WNT signaling pathway and impact on visual epilepsy highlight its significance in developmental and neurological contexts. DKK-1 Protein, Rat (HEK293, His) is the recombinant rat-derived DKK-1 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

DKK-1 Protein is predicted to play a crucial role in co-receptor binding, low-density lipoprotein particle receptor binding, and receptor antagonist activity. It is involved in the negative regulation of ossification and the positive regulation of neuron death, and its primary localization is in the extracellular space. This protein is implicated in anodontia, and its biased expression pattern is evident, with notable levels observed in the kidney (RPKM 4.7), brain (RPKM 0.6), and two other tissues. DKK-1's involvement in the WNT signaling pathway and its impact on visual epilepsy make it a significant factor in both developmental and neurological contexts.

Biological Activity

Measured by its ability to inhibit Wnt3a-induced alkaline phosphatase production by C3H10T1/2 cells. The ED50 for this effect is approximately 0.1097 μg/ml in the presence of 10 ng/mL of mouse Wnt3a, corresponding to a specific activity is 9115.7703 units/mg.

  • Measured by its ability to inhibit Wnt3a-induced alkaline phosphatase production by C3H10T1/2 cells. The ED50 for this effect is approximately 0.1097 μg/mL in the presence of 10 ng/mL of mouse Wnt3a, corresponding to a specific activity is 9115.7703 units/mg.
Species

Rat

Source

HEK293

Tag

C-6*His

Accession

A6I0Z0/NP_001099820.1 (T32-H270)

Gene ID
Molecular Construction
N-term
DKK-1 (T32-H270)
Accession # A6I0Z0/NP_001099820.1
6*His
C-term
Protein Length

Full Length of Mature Protein

Synonyms
dickkopf WNT signaling pathway inhibitor 1; Dickkopf-1; dickkopf-related protein 1; Dkk1; Dkk-1; hDkk-1
AA Sequence

TLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTLDNYQPYPCAEDEECGTDEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCPGNYCKNGICMPSDHSHLPRGEIEEGIIENLGNDHGAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCATGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLACRIQKDHHQTSNSSRLHTCQRH

분자량

Approximately 38.58 kDa

Purity
  • ≥ 95%, as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

선적

Room temperature in continental US; may vary elsewhere.

각종 서류

DKK-1 Protein, Rat (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

최근 본 상품:

온라인 문의

Your information is safe with us. * Required Fields.

DKK-1 Protein, Rat (HEK293, His)

 

Requested Quantity *

고객명 *

 

호칭

메일주소 *

 

전화번호 *

Department

 

회사명 *

City

Country or Region *

     

비고

대량구매 문의

Inquiry Information

상품명:
DKK-1 Protein, Rat (HEK293, His)
Cat. No.:
HY-P73305A
수량:
MCE Japan Authorized Agent: