1. Recombinant Proteins
  2. Others
  3. DLK-1 Protein, Cynomolgus (HEK293, His)

DLK-1, also known as pre adipokine, is a transmembrane-secreted protein with an epidermal growth factor (EGF) -like repeat sequence. DLK-1 regulates the growth of pioneer axons by controlling Wnt signaling. DLK-1 is a cell surface protein expressed in many cancers, including hepatocellular carcinoma, and maybe a potential target for monoclonal antibodies to treat cancer. DLK-1 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived DLK-1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

DLK-1, also known as pre adipokine, is a transmembrane-secreted protein with an epidermal growth factor (EGF) -like repeat sequence. DLK-1 regulates the growth of pioneer axons by controlling Wnt signaling. DLK-1 is a cell surface protein expressed in many cancers, including hepatocellular carcinoma, and maybe a potential target for monoclonal antibodies to treat cancer. DLK-1 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived DLK-1 protein, expressed by HEK293 , with C-His labeled tag.

Background

DLK-1, also known as pre adipokine, is a transmembrane-secreted protein with an epidermal growth factor (EGF) -like repeat sequence. DLK-1 is a member of the conserved MAPKKK double leucine zipper kinases (DLKs) that play a role in synaptic formation, axon regeneration and degeneration. DLK-1 regulates the growth of pioneer axons by controlling Wnt signaling. DLK-1 is a cell surface protein expressed in many cancers, including hepatocellular carcinoma, and maybe a potential target for monoclonal antibodies to treat cancer[1][2][3].

Biological Activity

Immobilized Cynomolgus DLK1, His Tag at 0.5 μg/ml (100 μl/well) on the plate. Dose response curve for Anti-DLK1 Antibody, hFc Tag with the EC50 of 10.2ng/ml determined by ELISA.

Species

Cynomolgus

Source

HEK293

Tag

C-8*His

Accession

XP_005562275.1 (A24-C306)

Gene ID
Molecular Construction
N-term
DLK-1 (A24-C306)
Accession # XP_005562275.1
8*His
C-term
Protein Length

Partial

Synonyms
pG2; FA1; DLK; DLK1; DLK-1; Pref1; secredeltin; ZOG
AA Sequence

AECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCEEPWQCICTDGWDGKLCDRDVRACSSTPCANNGTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASGPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTHLPSGYGLTYRLTPGVHELPVPQPEHRVLKVSMKELNKNTPLLTEGQAIC

Predicted Molecular Mass
31.3 kDa
Molecular Weight

Approximately 42-52 kDa,based on SDS-PAGE under reducing conditions,due to the glycosylation.

Purity

≥ 95%, as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

DLK-1 Protein, Cynomolgus (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

DLK-1 Protein, Cynomolgus (HEK293, His)

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
DLK-1 Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P700706
Quantity:
MCE Japan Authorized Agent: