DNA-binding protein HU-alpha Protein, E.coli (His-SUMO)

DNA-binding protein HU-alpha, a histone-like DNA-binding protein, wraps DNA, offering stabilization and preventing denaturation in challenging conditions. Comprising alpha and beta chains in a heterodimer, it demonstrates versatile DNA binding and protective functions. DNA-binding protein HU-alpha Protein, E.coli (His-SUMO) is the recombinant E. coli-derived DNA-binding protein HU-alpha protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

DNA-binding protein HU-alpha, a histone-like DNA-binding protein, exhibits the capacity to wrap DNA, providing stabilization and preventing denaturation under challenging environmental conditions. It forms a heterodimer consisting of an alpha and a beta chain, contributing to its functional versatility in DNA binding and protection.

E.coli

E. coli

N-SUMO;N-6*His

P0ACF2 (M1-K90)

914933  [NCBI]

Full Length

MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVK

Approximately 27 kDa

≥ 90%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HC1, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.