Copy Link Print Information

DNA-binding protein HU-alpha Protein, E.coli (His-SUMO)

1 Cited Publications
Customer Review

Based on 1 publication(s) in Google Scholar

DNA-binding protein HU-alpha, a histone-like DNA-binding protein, wraps DNA, offering stabilization and preventing denaturation in challenging conditions. Comprising alpha and beta chains in a heterodimer, it demonstrates versatile DNA binding and protective functions. DNA-binding protein HU-alpha Protein, E.coli (His-SUMO) is the recombinant E. coli-derived DNA-binding protein HU-alpha protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

For research use only. We do not sell to patients.
  • Species: E.coli
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • DNA-binding protein HU-alpha Protein, E.coli (His-SUMO) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

DNA-binding protein HU-alpha, a histone-like DNA-binding protein, wraps DNA, offering stabilization and preventing denaturation in challenging conditions. Comprising alpha and beta chains in a heterodimer, it demonstrates versatile DNA binding and protective functions. DNA-binding protein HU-alpha Protein, E.coli (His-SUMO) is the recombinant E. coli-derived DNA-binding protein HU-alpha protein, expressed by E. coli , with N-SUMO, N-6*His labeled tag.

Background

DNA-binding protein HU-alpha, a histone-like DNA-binding protein, exhibits the capacity to wrap DNA, providing stabilization and preventing denaturation under challenging environmental conditions. It forms a heterodimer consisting of an alpha and a beta chain, contributing to its functional versatility in DNA binding and protection.

Technical Parameters

  • Species E.coli
  • Source E. coli
  • Tag N-SUMO;N-6*His
  • Accession

    P0ACF2 (M1-K90)

  • Gene ID
    914933  [NCBI]
  • Molecular Construction
    • N-term
    • 6*His-SUMO
    • hupA (M1-K90)
      Accession # P0ACF2
    • C-term
  • Protein Length

    Full Length

  • Synonyms

    DNA-binding protein HU-alpha; HU-2; NS2; hupA; Z5576; ECs4923

  • AA Sequence

    MNKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKEGDAVQLVGFGTFKVNHRAERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVK

  • Predicted Molecular Mass

    25.5 kDa

  • Molecular Weight

    Approximately 27 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HC1, 0.5 M NaCl, 6% trehalose, pH 8.0.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • DNA-binding protein HU-alpha Protein, E.coli (His-SUMO) Product Image
    1/16
  • DNA-binding protein HU-alpha Protein, E.coli (His-SUMO) Product Image