DNAJC30 Protein, Human (His)

DNAJC30 is a neuron-enriched mitochondrial protein that plays a critical regulatory role in mitochondrial respiration. It binds to the ATP synthase complex and promotes ATP synthesis. DNAJC30 Protein, Human (His) is the recombinant human-derived DNAJC30 protein, expressed by E. coli , with N-His labeled tag.

DNAJC30, a mitochondrial protein enriched in neurons, assumes a crucial role as a regulator of mitochondrial respiration. This protein associates with the ATP synthase complex, playing a facilitative role in ATP synthesis. Additionally, it acts as a potential chaperone involved in the turnover of the subunits of mitochondrial complex I N-module, contributing to the degradation of N-module subunits damaged by oxidative stress and thereby enhancing the functional efficiency of complex I. Notably, DNAJC30's interaction with MT-ATP6 and ATP5MC2, both direct, underscores its involvement in these mitochondrial processes, shedding light on its significance in maintaining mitochondrial function and cellular homeostasis.

Human

E. coli

N-His

Q96LL9 (S39-G124)

84277  [NCBI]

Partial

SQGDCSYSRTALYDLLGVPSTATQAQIKAAYYRQCFLYHPDRNSGSAEAAERFTRISQAYVVLGSATLRRKYDRGLLSDEDLRGPG

Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

• 
  ≥ 95%, as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.