DNAJC30 Protein, Human (His)
Based on 1 Customer Validation
DNAJC30 is a neuron-enriched mitochondrial protein that plays a critical regulatory role in mitochondrial respiration. It binds to the ATP synthase complex and promotes ATP synthesis. DNAJC30 Protein, Human (His) is the recombinant human-derived DNAJC30 protein, expressed by E. coli , with N-His labeled tag.
- Species: Human
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
DNAJC30 is a neuron-enriched mitochondrial protein that plays a critical regulatory role in mitochondrial respiration. It binds to the ATP synthase complex and promotes ATP synthesis. DNAJC30 Protein, Human (His) is the recombinant human-derived DNAJC30 protein, expressed by E. coli , with N-His labeled tag.
DNAJC30, a mitochondrial protein enriched in neurons, assumes a crucial role as a regulator of mitochondrial respiration. This protein associates with the ATP synthase complex, playing a facilitative role in ATP synthesis. Additionally, it acts as a potential chaperone involved in the turnover of the subunits of mitochondrial complex I N-module, contributing to the degradation of N-module subunits damaged by oxidative stress and thereby enhancing the functional efficiency of complex I. Notably, DNAJC30's interaction with MT-ATP6 and ATP5MC2, both direct, underscores its involvement in these mitochondrial processes, shedding light on its significance in maintaining mitochondrial function and cellular homeostasis.
Technical Parameters
-
Species Human
-
Source E. coli
-
Tag N-His
-
Accession
Q96LL9 (S39-G124)
-
Molecular Construction
-
N-term
-
His
-
DNAJC30 (S39-G124)
Accession # Q96LL9 -
C-term
-
-
Protein Length
Partial
-
Synonyms
DNAJC30; Williams Beuren Syndrome Chromosome Region 18; Prev. WBSCR18; LHONAR1; Williams-Beuren Syndrome Chromosomal Region 18 Protein; MC1DN38; DnaJ Homolog Subfamily C Member 30, Mitochondrial; LHONAR; DnaJ Heat Shock Protein Family (Hsp40) Member C30;
-
AA Sequence
SQGDCSYSRTALYDLLGVPSTATQAQIKAAYYRQCFLYHPDRNSGSAEAAERFTRISQAYVVLGSATLRRKYDRGLLSDEDLRGPG
-
Molecular Weight
Approximately 14 kDa, based on SDS-PAGE under reducing conditions.
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (235 KB)
-
SDS (251 KB)
- English - EN (251 KB)
- Français - FR (251 KB)
- Deutsch - DE (251 KB)
- Norwegian - NO (251 KB)
- Español - ES (251 KB)
- Swedish - SV (251 KB)
- Italian - IT (251 KB)
- Korean - KR (251 KB)
- Portuguese - PT (251 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
