DNAJC30 Protein, Human (His)

Customer Review

Based on 1 Customer Validation

DNAJC30 is a neuron-enriched mitochondrial protein that plays a critical regulatory role in mitochondrial respiration. It binds to the ATP synthase complex and promotes ATP synthesis. DNAJC30 Protein, Human (His) is the recombinant human-derived DNAJC30 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: E. coli
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

DNAJC30 is a neuron-enriched mitochondrial protein that plays a critical regulatory role in mitochondrial respiration. It binds to the ATP synthase complex and promotes ATP synthesis. DNAJC30 Protein, Human (His) is the recombinant human-derived DNAJC30 protein, expressed by E. coli , with N-His labeled tag.

Background

DNAJC30, a mitochondrial protein enriched in neurons, assumes a crucial role as a regulator of mitochondrial respiration. This protein associates with the ATP synthase complex, playing a facilitative role in ATP synthesis. Additionally, it acts as a potential chaperone involved in the turnover of the subunits of mitochondrial complex I N-module, contributing to the degradation of N-module subunits damaged by oxidative stress and thereby enhancing the functional efficiency of complex I. Notably, DNAJC30's interaction with MT-ATP6 and ATP5MC2, both direct, underscores its involvement in these mitochondrial processes, shedding light on its significance in maintaining mitochondrial function and cellular homeostasis.

Technical Parameters

  • Species Human
  • Source E. coli
  • Tag N-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • His
    • DNAJC30 (S39-G124)
      Accession # Q96LL9
    • C-term
  • Protein Length

    Partial

  • Synonyms

    DNAJC30; Williams Beuren Syndrome Chromosome Region 18; Prev. WBSCR18; LHONAR1; Williams-Beuren Syndrome Chromosomal Region 18 Protein; MC1DN38; DnaJ Homolog Subfamily C Member 30, Mitochondrial; LHONAR; DnaJ Heat Shock Protein Family (Hsp40) Member C30;

  • AA Sequence

    SQGDCSYSRTALYDLLGVPSTATQAQIKAAYYRQCFLYHPDRNSGSAEAAERFTRISQAYVVLGSATLRRKYDRGLLSDEDLRGPG

  • Molecular Weight

    Approximately 14 kDa, based on SDS-PAGE under reducing conditions.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00