Copy Link Print Information

DNAM-1 Protein, Rat (HEK293, His)

Customer Review

Based on 1 Customer Validation

DNAM-1 protein is a key player in cell-cell adhesion and lymphocyte signaling, mediating cytotoxicity and lymphokine secretion of CTL and NK cells. As a receptor for NECTIN2, DNAM-1 stimulates T cell proliferation and cytokine production (IL2, IL5, IL10, IL13, and IFNG) upon ligand binding. DNAM-1 Protein, Rat (HEK293, His) is the recombinant rat-derived DNAM-1 protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Rat
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Experimental Validation Results for DNAM-1 Protein, Rat (HEK293, His)
  • Experimental Validation Results for DNAM-1 Protein, Rat (HEK293, His)
  • DNAM-1 Protein, Rat (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

DNAM-1 protein is a key player in cell-cell adhesion and lymphocyte signaling, mediating cytotoxicity and lymphokine secretion of CTL and NK cells. As a receptor for NECTIN2, DNAM-1 stimulates T cell proliferation and cytokine production (IL2, IL5, IL10, IL13, and IFNG) upon ligand binding. DNAM-1 Protein, Rat (HEK293, His) is the recombinant rat-derived DNAM-1 protein, expressed by HEK293 , with C-His labeled tag.

Background

The DNAM-1 protein is intricately involved in intercellular adhesion, lymphocyte signaling, cytotoxicity, and lymphokine secretion mediated by cytotoxic T-lymphocytes (CTL) and natural killer (NK) cells. Serving as a cell surface receptor for NECTIN2, DNAM-1, upon ligand binding, stimulates T-cell proliferation and the production of cytokines such as IL2, IL5, IL10, IL13, and IFNG. Furthermore, DNAM-1 competes with PVRIG for NECTIN2-binding, underscoring its regulatory role in cellular interactions and signaling pathways. This protein also interacts with PVR and NECTIN2, contributing to its multifaceted functions in immune responses and cellular communication.

Verified Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Rat DNAM-1 at 1 μg/mL (100 μL/well) can bind biotinylated CD155 Protein. The ED50 for this effect is 7.119 ng/mL.

MCE Validation Data

  • Purity - SDS-PAGE

    Purity - SDS-PAGE

    ≥ 95%, as determined by reducing SDS-PAGE.

  • Bioactivity - ELISA

    Bioactivity - ELISA

    Measured by its binding ability in a functional ELISA. Immobilized Rat DNAM-1 at 1 μg/mL (100 μL/well) can bind biotinylated CD155 Protein. The ED50 for this effect is 7.119 ng/mL.

Technical Parameters

  • Species Rat
  • Source HEK293
  • Tag C-His
  • Accession

    D3ZS97 (E32-I265)

  • Gene ID
    307199  [NCBI]
  • Molecular Construction
    • N-term
    • DNAM-1 (E32-I265)
      Accession # D3ZS97
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    CD226; PTA1; CD226 Molecule; T Lineage-Specific Activation Antigen 1 Antigen; CD226 Antigen; Platelet And T Cell Activation Antigen 1; DNAM-1; DNAX Accessory Molecule-1; DNAM1; DNAX Accessory Molecule 1; TLiSA1; Adhesion Glycoprotein

  • AA Sequence

    EETLWDTTVRLSETMTLECVYPLTDNLTQAEWTKDTGTKKVNIAVYHPNHNMHIDPNYLHRVHFQNATVGFRNMSLSFYNASEADIGIYTCLFHAFPRGSWEKKIKVVQSDSFETTAPLDSYLSAEPGQNVTLSCQLERTWLVQLVIWEKVQPHQVDILASCNLSQGTRYTSKYLRQTWSDCSQESMKSALIIPYAMAADSGLYRCRSEASTGTNKTCVIRLIITDGGTNNHFI

  • Molecular Weight

    Approximately 28 kDa.

  • Purity

    ≥ 95%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • 1/16

    MedChemExpress Validation
     ≥ 95%, as determined by reducing SDS-PAGE.

  • 1/16

    MedChemExpress Validation
     Measured by its binding ability in a functional ELISA. Immobilized Rat DNAM-1 at 1 μg/mL (100 μL/well) can bind biotinylated CD155 Protein. The ED50 for this effect is 7.119 ng/mL.

  • DNAM-1 Protein, Rat (HEK293, His) Product Image
    1/16
  • Experimental Validation Results for DNAM-1 Protein, Rat (HEK293, His)
  • Experimental Validation Results for DNAM-1 Protein, Rat (HEK293, His)
  • DNAM-1 Protein, Rat (HEK293, His) Product Image