Copy Link Print Information

DR3/TNFRSF25 Protein, Human (HEK293, His)

DR3/TNFRSF25 Protein, the receptor for TNFSF12/APO3L/TWEAK, interacts with adapter TRADD, activating NF-kappa-B and inducing apoptosis. It may crucially regulate lymphocyte homeostasis. Forming homodimers, it strongly interacts with TNFRSF1 and TRADD via death domains, initiating distinct apoptosis and NF-kappa-B signaling cascades. Interaction with BAG4 contributes to its multifaceted cellular response roles. DR3/TNFRSF25 Protein, Human (HEK293, His) is the recombinant human-derived DR3/TNFRSF25 protein, expressed by HEK293, with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Human
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • DR3/TNFRSF25 Protein, Human (HEK293, His) Product Image
Size
Price
Stock
Quantity
Amount: USD 0.00
Please select quantity
or
or

* Please select Quantity before adding items.

To place orders, for customer services and technical support, please contact: MedChemExpress USA

Tel: 609-228-6898 E-mail: [email protected] [email protected]

Service
Data Download

To place orders, for customer services and technical support, please contact:

609-228-6898
[email protected] [email protected]
Find Your Local Distributor Your local distributor: Hycultec GmbHHycultec
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs
Top Publications Citing

Use of MCE Products

Biological Activity

Description

DR3/TNFRSF25 Protein, the receptor for TNFSF12/APO3L/TWEAK, interacts with adapter TRADD, activating NF-kappa-B and inducing apoptosis. It may crucially regulate lymphocyte homeostasis. Forming homodimers, it strongly interacts with TNFRSF1 and TRADD via death domains, initiating distinct apoptosis and NF-kappa-B signaling cascades. Interaction with BAG4 contributes to its multifaceted cellular response roles. DR3/TNFRSF25 Protein, Human (HEK293, His) is the recombinant human-derived DR3/TNFRSF25 protein, expressed by HEK293, with C-His labeled tag.

Background

DR3/TNFRSF25 Protein serves as the receptor for TNFSF12/APO3L/TWEAK and directly interacts with the adapter TRADD. This interaction leads to the activation of NF-kappa-B and induction of apoptosis. The protein may play a crucial role in regulating lymphocyte homeostasis. It forms homodimers and exhibits strong interactions via the death domains with TNFRSF1 and TRADD, initiating distinct signaling cascades involved in apoptosis and NF-kappa-B signaling. Additionally, DR3/TNFRSF25 interacts with BAG4, contributing to its multifaceted roles in cellular responses.

Technical Parameters

  • Species Human
  • Source HEK293
  • Tag C-His
  • Accession

    Q93038 (Q25-Q199)

  • Gene ID
    8718
  • Molecular Construction
    • N-term
    • DR3 (Q25-Q199)
      Accession # Q93038
    • His
    • C-term
  • Protein Length

    Extracellular Domain

  • Synonyms

    TNFRSF25; Apoptosis-Mediating Receptor DR3; Prev. TNFRSF12; Protein WSL-1; LARD; Tumor Necrosis Factor Receptor Superfamily Member 25 Deletion Mutant; DDR3; Tumor Necrosis Factor Receptor Superfamily, Member 25; DR3; Death Domain Receptor 3 Soluble Form;

  • AA Sequence

    QGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPTSTLGSCPERCAAVCGWRQ

  • Predicted Molecular Mass

    20.9 kDa

  • Molecular Weight

    Approximately 30-37 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

  • Glycosylation

    Yes

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00

Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated CTLL-2 mouse cytotoxic T cells. The ED50 this effect is 0.8023 μg/ml, corresponding to a specific activity is 1246.42 units/mg.

Assay Types
  • DR3/TNFRSF25 Protein, Human (HEK293, His) Product Image
    1/16
  • DR3/TNFRSF25 Protein, Human (HEK293, His) Product Image