DRE1C Protein, Rice
DRE1C Protein, Rice is the recombinant DRE1C, expressed by E. coli , with tag Free labeled tag.
- Species: Others
- Source: E. coli
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
DRE1C Protein, Rice is the recombinant DRE1C, expressed by E. coli , with tag Free labeled tag.
Background
DRE1C is a transcriptional activator that specifically binds to the DNA sequence 5'-[AG]CCGAC-3'. Its interaction with the C-repeat/DRE element mediates transcription induced by high salinity and dehydration (by similar).
Technical Parameters
-
Species Others
-
Source E. coli
-
Tag Tag Free
-
Accession
Q9LWV3 (R30-S120)
-
Gene ID4339974
-
Protein Length
Partial
-
Synonyms
Dehydration-responsive element-binding protein 1C; Protein DREB1C; Protein C-repeat-binding factor 1; DREB1C; CBF1; ERF26; OsJ_019159; OSJNBa0038F22.13; P0425F02.47; Os06g0127100; LOC_Os06g03670
-
AA Sequence
RHPVYRGVRRRGPAGRWVCEVREPNKKSRIWLGTFATAEAAARAHDVAALALRGRGACLNFADSARLLRVDPATLATPDDIRRAAIELAES
-
Predicted Molecular Mass
10.2 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution.
<1 EU/μg, determined by LAL method.
Please use rapid thawing with running water to thaw the protein.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
