DTE Protein, Pseudomonas cichorii (His, Myc)
DTE Protein, Pseudomonas cichorii (His, Myc) is the recombinant pseudomonas cichorii-derived DTE protein, expressed by E. coli, with N-10*His & C-Myc tag.
- Source: E. coli
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
DTE Protein, Pseudomonas cichorii (His, Myc) is the recombinant pseudomonas cichorii-derived DTE protein, expressed by E. coli, with N-10*His & C-Myc tag.
Background
DTE catalyzes the epimerization of various ketoses at the C(3) position, interconverting D-tagatose and D-ribulose to D-sorbose and D-xylulose, respectively. The enzyme also exhibits lower efficiency with other ketopentoses such as D-psicose.
Technical Parameters
-
Source E. coli
-
Tag N-10*His;C-Myc
-
Accession
O50580 (M1-A290)
-
Gene ID/
-
Molecular Construction
-
N-term
-
10*His
-
DTE (M1-A290)
Accession # O50580 -
Myc
-
C-term
-
-
Protein Length
Full Length
-
Synonyms
D-tagatose 3-epimerase; EC:5.1.3.31; DTE; D-ribulose 3-epimerase; Ketose 3-epimerase
-
AA Sequence
MNKVGMFYTYWSTEWMVDFPATAKRIAGLGFDLMEISLGEFHNLSDAKKRELKAVADDLGLTVMCCIGLKSEYDFASPDKSVRDAGTEYVKRLLDDCHLLGAPVFAGLTFCAWPQSPPLDMKDKRPYVDRAIESVRRVIKVAEDYGIIYALEVVNRFEQWLCNDAKEAIAFADAVDSPACKVQLDTFHMNIEETSFRDAILACKGKMGHFHLGEANRLPPGEGRLPWDEIFGALKEIGYDGTIVMEPFMRKGGSVSRAVGVWRDMSNGATDEEMDERARRSLQFVRDKLA
-
Predicted Molecular Mass
40.1 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder.
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
