E2/Envelope 2 Protein, Chikungunya virus (sf9, His)

E/Envelope Protein, Chikungunya virus (sf9, His) is the recombinant Virus-derived E/Envelope protein, expressed by Sf9 insect cells, with C-His labeled tag.

E2/Envelope 2 is a Class II viral fusion protein. Its fusion activity remains inactive as long as E1 is bound to E2 in the mature virion. Following virus attachment to the target cell and endocytosis, acidification of the endosome triggers the dissociation of the E1/E2 heterodimer and concurrent trimerization of E1 subunits. This E1 trimer becomes fusion-active and facilitates the release of the viral nucleocapsid into the cytoplasm after fusion of the endosomal and viral membranes. Efficient fusion requires the presence of cholesterol and sphingolipid in the target membrane, with optimal fusion occurring at a ratio of approximately 1 cholesterol molecule per 2 phospholipid molecules, and specificity for sterols containing a 3-beta-hydroxyl group.

Virus

Sf9 insect cells

C-His

ADG95913 (S326-Q666)

/

Partial

STKDNFNVYKATRPYLAHCPDCGEGHSCHSPVALERIRNEATDGTLKIQVSLQIGIKTDDSHDWTKLRYMDNHMPADAERAGLFVRTSAPCTITGTMGHFILARCPKGETLTVGFTDSRKISHSCTHPFHHDPPVIGREKFHSRPQHGKELPCSTYVQSTAATTEEIEVHMPPDTPDRTLMSQQSGNVKITVNGQTVRYKCNCGGSNEGLTTTDKVINNCKVDQCHAAVTNHKKWQYNSPLVPRNAELGDRKGKIHIPFPLANVTCRVPKARNPTVTYGKNQVIMLLYPDHPTLLSYRNMGEEPNYQEEWVMHKKEVVLTVPTEGLEVTWGNNEPYKYWPQ

39.8 kDa

≥ 90%, as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.22 μm filtered solution of 20 mM Tris, pH 7.5, 500 mM NaCl, 10% Glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.