E2/Envelope 2 Protein, Chikungunya virus (sf9, His)
Based on 1 publication(s) in Google Scholar
E/Envelope Protein, Chikungunya virus (sf9, His) is the recombinant Virus-derived E/Envelope protein, expressed by Sf9 insect cells, with C-His labeled tag.
- Species: Virus
- Source: Sf9 insect cells
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
E/Envelope Protein, Chikungunya virus (sf9, His) is the recombinant Virus-derived E/Envelope protein, expressed by Sf9 insect cells, with C-His labeled tag.
Background
E2/Envelope 2 is a Class II viral fusion protein. Its fusion activity remains inactive as long as E1 is bound to E2 in the mature virion. Following virus attachment to the target cell and endocytosis, acidification of the endosome triggers the dissociation of the E1/E2 heterodimer and concurrent trimerization of E1 subunits. This E1 trimer becomes fusion-active and facilitates the release of the viral nucleocapsid into the cytoplasm after fusion of the endosomal and viral membranes. Efficient fusion requires the presence of cholesterol and sphingolipid in the target membrane, with optimal fusion occurring at a ratio of approximately 1 cholesterol molecule per 2 phospholipid molecules, and specificity for sterols containing a 3-beta-hydroxyl group.
Publications (1)
-
Journal Impact Factor
-
Most Recent
-
J Immunol Methods
Development of a sensitive sandwich ELISA for the envelope domain III protein of dengue virus type 2. [Abstract]2025 Dec:545:114000. PMID: 41183705
Technical Parameters
-
Species Virus
-
Source Sf9 insect cells
-
Tag C-His
-
Accession
ADG95913 (S326-Q666)
-
Gene ID/
-
Molecular Construction
-
N-term
-
CHIKV-E2 (S326-Q666)
Accession # ADG95913 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
CHIKV; CHIKV Envelope / CHIKV-E Protein
-
AA Sequence
STKDNFNVYKATRPYLAHCPDCGEGHSCHSPVALERIRNEATDGTLKIQVSLQIGIKTDDSHDWTKLRYMDNHMPADAERAGLFVRTSAPCTITGTMGHFILARCPKGETLTVGFTDSRKISHSCTHPFHHDPPVIGREKFHSRPQHGKELPCSTYVQSTAATTEEIEVHMPPDTPDRTLMSQQSGNVKITVNGQTVRYKCNCGGSNEGLTTTDKVINNCKVDQCHAAVTNHKKWQYNSPLVPRNAELGDRKGKIHIPFPLANVTCRVPKARNPTVTYGKNQVIMLLYPDHPTLLSYRNMGEEPNYQEEWVMHKKEVVLTVPTEGLEVTWGNNEPYKYWPQ
-
Predicted Molecular Mass
39.8 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of 20 mM Tris, pH 7.5, 500 mM NaCl, 10% Glycerol.
Note: For SPR assay, please replace the buffer. Primary amine components (e.g., Tris, imidazole) can affect protein-coupled chips.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
