E/Envelope Protein, Dengue virus 1 (101a.a, HEK293, His)

The NS1 protein plays a key role in viral budding, association with cell membranes, and facilitating the assembly of viral RNA into nucleocapsids to form mature viral particles.During entry, NS1 induces genome penetration into the host cytoplasm.E/Envelope Protein, Dengue virus 1 (101a.a, HEK293, His) is the recombinant Virus-derived E/Envelope protein, expressed by HEK293 , with C-His labeled tag.

For research use only. We do not sell to patients.
  • Species: Virus
  • Source: HEK293
  • Storage:
    Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
  • Biological Activity
  • Technical Parameters
  • Product Properties
  • Documentation
  • Help & FAQs

Biological Activity

Description

The NS1 protein plays a key role in viral budding, association with cell membranes, and facilitating the assembly of viral RNA into nucleocapsids to form mature viral particles.During entry, NS1 induces genome penetration into the host cytoplasm.E/Envelope Protein, Dengue virus 1 (101a.a, HEK293, His) is the recombinant Virus-derived E/Envelope protein, expressed by HEK293 , with C-His labeled tag.

Background

The NS1 protein assumes a pivotal role in virus budding by binding to the cell membrane, facilitating the assembly of the viral RNA into a nucleocapsid that forms the core of a mature virus particle. During virus entry, NS1 may induce genome penetration into the host cytoplasm following hemifusion induced by surface proteins. Notably, NS1 exhibits the ability to migrate to the cell nucleus, where it modulates host functions. Additionally, NS1 counteracts the antiviral effects of host EXOC1 by sequestering and degrading EXOC1 through the proteasome degradation pathway. Furthermore, NS1 disrupts RNA silencing by interfering with host Dicer, highlighting its multifaceted role in manipulating both viral and host cellular processes throughout the infection cycle.

Technical Parameters

  • Species Virus
  • Source HEK293
  • Tag C-His
  • Accession
  • Gene ID
  • Molecular Construction
    • N-term
    • DENV1 E (V580-K680)
      Accession # ACF49259
    • His
    • C-term
  • Protein Length

    Partial

  • Synonyms

    E Protein; DENV; DENV Envelope / DENV-E Protein (His Tag)

  • AA Sequence

    VMCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSTQDEKGVTQNGRLITANPIVTDKEKPVNIEAEPPFGESYIVVGAGEKALKLSWFKKGSSIGK

  • Predicted Molecular Mass

    12.4 kDa

  • Purity

    ≥ 90%, as determined by reducing SDS-PAGE.

Product Properties

Appearance

Lyophilized powder

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Calculators

Reconstitution Calculator

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) Volume (to add to vial)
=
Mass (in vial) Mass (in vial)
÷
Desired Reconstitution Concentration Desired Reconstitution Concentration
Dilution Calculator

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

Concentration (start) Concentration (start)
×
Volume (start) Volume (start)
=
Concentration (final) Concentration (final)
×
Volume (final) Volume (final)
The Specific Activity Calculator Equation
  • Specific Activity (Unit/mg)
  • Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) Specific Activity (Unit/mg)
Unit/mg
= 106 ÷
Biological Activity (ED50) Biological Activity (ED50)
106 ÷
ng/mL
MOQ
Minimum order quantity
100 mg

Get Quote In-stock

Other size
Get Quote
Please select quantity
Amount: USD 0.00