E/Envelope Protein, Dengue virus 1 (101a.a, HEK293, His)
The NS1 protein plays a key role in viral budding, association with cell membranes, and facilitating the assembly of viral RNA into nucleocapsids to form mature viral particles.During entry, NS1 induces genome penetration into the host cytoplasm.E/Envelope Protein, Dengue virus 1 (101a.a, HEK293, His) is the recombinant Virus-derived E/Envelope protein, expressed by HEK293 , with C-His labeled tag.
- Species: Virus
- Source: HEK293
-
Storage:Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
The NS1 protein plays a key role in viral budding, association with cell membranes, and facilitating the assembly of viral RNA into nucleocapsids to form mature viral particles.During entry, NS1 induces genome penetration into the host cytoplasm.E/Envelope Protein, Dengue virus 1 (101a.a, HEK293, His) is the recombinant Virus-derived E/Envelope protein, expressed by HEK293 , with C-His labeled tag.
Background
The NS1 protein assumes a pivotal role in virus budding by binding to the cell membrane, facilitating the assembly of the viral RNA into a nucleocapsid that forms the core of a mature virus particle. During virus entry, NS1 may induce genome penetration into the host cytoplasm following hemifusion induced by surface proteins. Notably, NS1 exhibits the ability to migrate to the cell nucleus, where it modulates host functions. Additionally, NS1 counteracts the antiviral effects of host EXOC1 by sequestering and degrading EXOC1 through the proteasome degradation pathway. Furthermore, NS1 disrupts RNA silencing by interfering with host Dicer, highlighting its multifaceted role in manipulating both viral and host cellular processes throughout the infection cycle.
Technical Parameters
-
Species Virus
-
Source HEK293
-
Tag C-His
-
Accession
ACF49259 (V580-K680)
-
Gene ID/
-
Molecular Construction
-
N-term
-
DENV1 E (V580-K680)
Accession # ACF49259 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
E Protein; DENV; DENV Envelope / DENV-E Protein (His Tag)
-
AA Sequence
VMCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSTQDEKGVTQNGRLITANPIVTDKEKPVNIEAEPPFGESYIVVGAGEKALKLSWFKKGSSIGK
-
Predicted Molecular Mass
12.4 kDa
-
Purity
≥ 90%, as determined by reducing SDS-PAGE.
Product Properties
Lyophilized powder
<1 EU/μg, determined by LAL method.
It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).
Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.
Room temperature in continental US; may vary elsewhere.
Documentation
-
Data Sheet (236 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
