E/Envelope Protein, Dengue virus 2 (102a.a, P.pastoris, His)
Based on 1 Customer Validation
E/Envelope Protein, Dengue virus 2 (102a.a, P.pastoris, His) is the recombinant Virus-derived E/Envelope protein, expressed by P. pastoris, with C-His labeled tag.
- Species: Virus
- Source: P. pastoris
-
Storage:Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
To place orders, for customer services and technical support, please contact: MedChemExpress USA
Tel: 609-228-6898 E-mail: [email protected] [email protected]
-
Biological Activity
-
Technical Parameters
-
Product Properties
- Documentation
- Help & FAQs
Biological Activity
Description
E/Envelope Protein, Dengue virus 2 (102a.a, P.pastoris, His) is the recombinant Virus-derived E/Envelope protein, expressed by P. pastoris, with C-His labeled tag.
Background
E/Envelope acts as a chaperone for the envelope protein E during intracellular virion assembly by masking and inactivating the fusion peptide of envelope protein E. prM is the only viral peptide matured by host furin in the trans-Golgi network, likely to prevent catastrophic activation of viral fusion activity in the acidic Golgi compartment before virion release. prM-E cleavage is inefficient, resulting in many virions being only partially matured. These uncleaved prM may contribute to immune evasion.
Technical Parameters
-
Species Virus
-
Source P. pastoris
-
Tag C-His
-
Accession
AAC59274.1 (G534-G675)
-
Gene ID/
-
Molecular Construction
-
N-term
-
DENV2 E (G534-G675)
Accession # AAC59274.1 -
His
-
C-term
-
-
Protein Length
Partial
-
Synonyms
E Protein; DENV; Dengue virus (DENV) (type 2, strain New Guinea C/PUO-218 hybrid) E / Envelope Protein (Domain III, His Tag)
-
AA Sequence
GSQEGAMHTALTGATEIQMSSGNLLFTGHLKCRLRMDKLQLKGMSYSMCTGKFKVVKEIAETQHGTIVIRVQYEGDGSPCKIPFEIMDLEKRHVLGRLITVNPIVTEKDSPVNIEAEPPFGDSYIIIGVEPGQLKLNWFKKG
-
Predicted Molecular Mass
17.1 kDa
-
Purity
≥ 95%, as determined by reducing SDS-PAGE.
Product Properties
Solution
Supplied as a 0.22 μm filtered solution of PBS, pH 7.4.
<1 EU/μg, determined by LAL method.
Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping with dry ice.
Documentation
-
Data Sheet (233 KB)
-
SDS (252 KB)
- English - EN (252 KB)
- Français - FR (252 KB)
- Deutsch - DE (252 KB)
- Norwegian - NO (252 KB)
- Español - ES (252 KB)
- Swedish - SV (252 KB)
- Italian - IT (252 KB)
- Korean - KR (252 KB)
- Portuguese - PT (252 KB)
-
Handling Instructions (2659 KB)
Calculators
Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
Powered by Bioz
